Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286USR1

Protein Details
Accession A0A286USR1   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
18-47FQSSRVHDKTKNKKPKTKTKNNNKQTQHQFHydrophilic
NLS Segment(s)
PositionSequence
28-35KNKKPKTK
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MIDNSRVFIFKQALPFPFQSSRVHDKTKNKKPKTKTKNNNKQTQHQFIFRWWTGKLSSGRGRDFQHVNVTNAIIHLGYSQLSQSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.35
4 0.34
5 0.34
6 0.31
7 0.34
8 0.4
9 0.41
10 0.46
11 0.48
12 0.55
13 0.63
14 0.71
15 0.75
16 0.75
17 0.79
18 0.82
19 0.86
20 0.86
21 0.87
22 0.86
23 0.87
24 0.89
25 0.89
26 0.9
27 0.83
28 0.82
29 0.78
30 0.76
31 0.67
32 0.6
33 0.52
34 0.45
35 0.48
36 0.39
37 0.33
38 0.24
39 0.24
40 0.2
41 0.26
42 0.26
43 0.26
44 0.32
45 0.35
46 0.37
47 0.39
48 0.42
49 0.41
50 0.42
51 0.38
52 0.41
53 0.39
54 0.38
55 0.35
56 0.33
57 0.28
58 0.25
59 0.23
60 0.12
61 0.09
62 0.08
63 0.07
64 0.07
65 0.07