Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UCH7

Protein Details
Accession A0A286UCH7    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-31PHCIQPHTKIQRRSKSPHKFHLIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 11.5, cyto 7.5, mito 5
Family & Domain DBs
Amino Acid Sequences MILDEVDIPHCIQPHTKIQRRSKSPHKFHLITPQIPSLYQWSRVGQFPGDFVYGLCSRGTQTLNPQIKECRSAFTVLTKAIVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.38
3 0.45
4 0.53
5 0.62
6 0.71
7 0.76
8 0.8
9 0.8
10 0.81
11 0.81
12 0.81
13 0.8
14 0.72
15 0.66
16 0.69
17 0.64
18 0.55
19 0.5
20 0.43
21 0.34
22 0.32
23 0.3
24 0.24
25 0.19
26 0.2
27 0.19
28 0.17
29 0.19
30 0.2
31 0.2
32 0.15
33 0.14
34 0.12
35 0.12
36 0.11
37 0.1
38 0.09
39 0.12
40 0.11
41 0.12
42 0.11
43 0.1
44 0.1
45 0.14
46 0.16
47 0.13
48 0.2
49 0.29
50 0.36
51 0.36
52 0.39
53 0.41
54 0.42
55 0.47
56 0.4
57 0.35
58 0.3
59 0.32
60 0.3
61 0.31
62 0.32
63 0.27