Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UU04

Protein Details
Accession A0A286UU04    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-44VKDRTRRTSCRSCKRLHCKCERDNTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
Amino Acid Sequences MTDPSVNSPNTTYKFVSYVKDRTRRTSCRSCKRLHCKCERDNTSESCANCKKKGRICETDDLEGGTKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.33
4 0.32
5 0.38
6 0.43
7 0.5
8 0.51
9 0.56
10 0.62
11 0.64
12 0.67
13 0.69
14 0.7
15 0.72
16 0.76
17 0.74
18 0.76
19 0.8
20 0.81
21 0.79
22 0.79
23 0.77
24 0.77
25 0.8
26 0.75
27 0.7
28 0.65
29 0.59
30 0.55
31 0.5
32 0.44
33 0.41
34 0.44
35 0.43
36 0.44
37 0.49
38 0.52
39 0.55
40 0.65
41 0.66
42 0.67
43 0.69
44 0.73
45 0.7
46 0.66
47 0.59
48 0.51