Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UVL2

Protein Details
Accession A0A286UVL2   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-51QGQPVQKRGRGRPKGSKNKSKPEGNVHydrophilic
69-97VPDNEQPKAKKPRGRPKKQGTTNATKPGAHydrophilic
NLS Segment(s)
PositionSequence
32-87KRGRGRPKGSKNKSKPEGNVPAAASGEPGRKRGRPRKVPDNEQPKAKKPRGRPKKQ
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSASPTTAQDPAKQTDNEGGGSHSDQGQPVQKRGRGRPKGSKNKSKPEGNVPAAASGEPGRKRGRPRKVPDNEQPKAKKPRGRPKKQGTTNATKPGANDEDDVEDQQPVKKRSRTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.34
4 0.3
5 0.26
6 0.23
7 0.19
8 0.2
9 0.19
10 0.15
11 0.14
12 0.13
13 0.16
14 0.22
15 0.23
16 0.28
17 0.33
18 0.35
19 0.41
20 0.5
21 0.59
22 0.6
23 0.65
24 0.7
25 0.75
26 0.83
27 0.85
28 0.87
29 0.84
30 0.85
31 0.85
32 0.8
33 0.73
34 0.7
35 0.7
36 0.61
37 0.55
38 0.45
39 0.38
40 0.32
41 0.28
42 0.2
43 0.13
44 0.15
45 0.12
46 0.16
47 0.17
48 0.21
49 0.31
50 0.39
51 0.48
52 0.54
53 0.61
54 0.69
55 0.75
56 0.79
57 0.79
58 0.8
59 0.73
60 0.72
61 0.68
62 0.66
63 0.68
64 0.66
65 0.64
66 0.65
67 0.73
68 0.75
69 0.81
70 0.83
71 0.84
72 0.89
73 0.9
74 0.9
75 0.87
76 0.85
77 0.82
78 0.8
79 0.71
80 0.61
81 0.53
82 0.49
83 0.44
84 0.36
85 0.29
86 0.22
87 0.25
88 0.25
89 0.26
90 0.2
91 0.19
92 0.18
93 0.22
94 0.28
95 0.27
96 0.34
97 0.39