Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286U9K9

Protein Details
Accession A0A286U9K9    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-28VAKHGYNLRSSKKRRTNPRRFDSEAAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MSVAKHGYNLRSSKKRRTNPRRFDSEAARIASQKTFGLVPVISFALDRPLPTVVVPIDESDSDSEETHGNDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.81
4 0.85
5 0.87
6 0.88
7 0.9
8 0.87
9 0.83
10 0.78
11 0.73
12 0.69
13 0.62
14 0.53
15 0.45
16 0.37
17 0.33
18 0.28
19 0.23
20 0.15
21 0.11
22 0.09
23 0.08
24 0.09
25 0.08
26 0.07
27 0.07
28 0.07
29 0.07
30 0.06
31 0.06
32 0.09
33 0.09
34 0.09
35 0.09
36 0.1
37 0.1
38 0.1
39 0.13
40 0.09
41 0.11
42 0.12
43 0.11
44 0.12
45 0.12
46 0.13
47 0.12
48 0.14
49 0.14
50 0.14
51 0.14
52 0.14