Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BT26

Protein Details
Accession G8BT26   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-84GEKRARKVAKKRLGSFKRAKBasic
NLS Segment(s)
PositionSequence
66-86EKRARKVAKKRLGSFKRAKAK
Subcellular Location(s) mito 19, cyto 5.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tpf:TPHA_0D03620  -  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAVKTGIAVGLNKGKKVTSMTPAPKISYRKGAASKRTTFVRSIVREFAGLAPYERRLMDVIRNVGEKRARKVAKKRLGSFKRAKAKVEEMTNIIAASRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.28
4 0.28
5 0.27
6 0.34
7 0.39
8 0.46
9 0.47
10 0.48
11 0.48
12 0.49
13 0.46
14 0.45
15 0.41
16 0.4
17 0.47
18 0.51
19 0.54
20 0.57
21 0.57
22 0.52
23 0.54
24 0.5
25 0.42
26 0.4
27 0.39
28 0.34
29 0.34
30 0.32
31 0.28
32 0.26
33 0.26
34 0.22
35 0.15
36 0.12
37 0.1
38 0.09
39 0.09
40 0.1
41 0.09
42 0.09
43 0.09
44 0.1
45 0.13
46 0.17
47 0.18
48 0.19
49 0.21
50 0.2
51 0.24
52 0.29
53 0.28
54 0.28
55 0.36
56 0.39
57 0.45
58 0.56
59 0.62
60 0.66
61 0.72
62 0.76
63 0.77
64 0.79
65 0.8
66 0.8
67 0.79
68 0.79
69 0.74
70 0.69
71 0.64
72 0.65
73 0.62
74 0.59
75 0.52
76 0.44
77 0.43
78 0.4
79 0.33
80 0.26