Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UC86

Protein Details
Accession A0A286UC86   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
164-193AKRSFVSCCYLRKRRNYRKGRSQRKSWRSIHydrophilic
NLS Segment(s)
PositionSequence
86-107EAKEKERQKEKAAENKKRKRSR
175-191RKRRNYRKGRSQRKSWR
Subcellular Location(s) nucl 15, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR039715  ZCCHC10  
Pfam View protein in Pfam  
PF13917  zf-CCHC_3  
Amino Acid Sequences MSKYAPHKPSASNPRASSSTLCQKCLQKGHFTYQCKGSRPYVSRPSRTQMLEKPGLLAKLKAEGKPSVEVPEEFKNKSGTANKILEAKEKERQKEKAAENKKRKRSRSSNSESSDSDSDSDSSSGSDSDSDSDSDSGSSDAGGGEAPPEVALGRVMIITKELGAKRSFVSCCYLRKRRNYRKGRSQRKSWRSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.57
3 0.54
4 0.47
5 0.44
6 0.48
7 0.43
8 0.44
9 0.44
10 0.47
11 0.52
12 0.57
13 0.53
14 0.52
15 0.53
16 0.6
17 0.63
18 0.62
19 0.59
20 0.6
21 0.62
22 0.57
23 0.56
24 0.52
25 0.52
26 0.52
27 0.57
28 0.58
29 0.6
30 0.63
31 0.63
32 0.64
33 0.61
34 0.59
35 0.56
36 0.51
37 0.51
38 0.49
39 0.44
40 0.41
41 0.36
42 0.36
43 0.3
44 0.25
45 0.17
46 0.21
47 0.23
48 0.22
49 0.24
50 0.23
51 0.24
52 0.26
53 0.26
54 0.21
55 0.2
56 0.2
57 0.2
58 0.26
59 0.27
60 0.25
61 0.26
62 0.25
63 0.23
64 0.28
65 0.29
66 0.25
67 0.28
68 0.29
69 0.29
70 0.32
71 0.32
72 0.32
73 0.31
74 0.3
75 0.31
76 0.34
77 0.38
78 0.39
79 0.42
80 0.41
81 0.46
82 0.48
83 0.52
84 0.57
85 0.63
86 0.68
87 0.74
88 0.8
89 0.8
90 0.8
91 0.8
92 0.8
93 0.79
94 0.79
95 0.78
96 0.77
97 0.73
98 0.7
99 0.61
100 0.55
101 0.46
102 0.35
103 0.28
104 0.19
105 0.16
106 0.13
107 0.12
108 0.08
109 0.08
110 0.07
111 0.07
112 0.06
113 0.06
114 0.06
115 0.07
116 0.08
117 0.08
118 0.09
119 0.09
120 0.09
121 0.09
122 0.09
123 0.07
124 0.06
125 0.06
126 0.05
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.06
143 0.05
144 0.06
145 0.06
146 0.07
147 0.13
148 0.14
149 0.17
150 0.17
151 0.19
152 0.2
153 0.26
154 0.26
155 0.22
156 0.27
157 0.29
158 0.37
159 0.45
160 0.54
161 0.56
162 0.66
163 0.76
164 0.81
165 0.87
166 0.89
167 0.9
168 0.91
169 0.95
170 0.95
171 0.93
172 0.93
173 0.93