Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UFV8

Protein Details
Accession A0A286UFV8   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-55LAIPPERRRRTKREDQTVNNNVTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007192  APC8  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
Pfam View protein in Pfam  
PF04049  ANAPC8  
Amino Acid Sequences MEGNYVVHLRKAVKDCTDRGLYHASKWASELLLAIPPERRRRTKREDQTVNNNVTIQENVNVNGVESPEVLEAVWEEDEQDLLAASRALAEAKEYMRASKLLLDCKSARGRFMRWYFDFLAEEKRALRDWHNLDYTLQHNSKSTGPSHAPSNPRPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.48
4 0.51
5 0.44
6 0.43
7 0.46
8 0.39
9 0.35
10 0.4
11 0.34
12 0.28
13 0.29
14 0.27
15 0.19
16 0.18
17 0.16
18 0.1
19 0.13
20 0.13
21 0.13
22 0.16
23 0.22
24 0.31
25 0.37
26 0.45
27 0.49
28 0.58
29 0.67
30 0.73
31 0.78
32 0.79
33 0.82
34 0.8
35 0.83
36 0.81
37 0.74
38 0.64
39 0.54
40 0.43
41 0.34
42 0.28
43 0.18
44 0.13
45 0.11
46 0.11
47 0.12
48 0.11
49 0.1
50 0.1
51 0.09
52 0.07
53 0.06
54 0.07
55 0.05
56 0.06
57 0.05
58 0.04
59 0.04
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.06
79 0.06
80 0.11
81 0.11
82 0.11
83 0.12
84 0.13
85 0.13
86 0.16
87 0.19
88 0.21
89 0.22
90 0.26
91 0.25
92 0.31
93 0.38
94 0.33
95 0.34
96 0.31
97 0.33
98 0.38
99 0.42
100 0.45
101 0.39
102 0.44
103 0.42
104 0.41
105 0.39
106 0.32
107 0.34
108 0.27
109 0.26
110 0.22
111 0.22
112 0.22
113 0.23
114 0.25
115 0.27
116 0.31
117 0.36
118 0.38
119 0.37
120 0.36
121 0.37
122 0.36
123 0.35
124 0.32
125 0.26
126 0.25
127 0.26
128 0.29
129 0.29
130 0.28
131 0.27
132 0.3
133 0.32
134 0.36
135 0.41
136 0.44