Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UP25

Protein Details
Accession A0A286UP25    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-32STPIPPSSSKQNKKNQTQGNTRSVTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 7, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR019775  WD40_repeat_CS  
IPR036322  WD40_repeat_dom_sf  
IPR037590  WDR24  
Gene Ontology GO:0032008  P:positive regulation of TOR signaling  
PROSITE View protein in PROSITE  
PS00678  WD_REPEATS_1  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences MMRHYAFSTPIPPSSSKQNKKNQTQGNTRSVTCYNASSPGGSAISKSPDEERCVVAGKDSLRILRVSDGSERPTLEHKFAIGKGGYRIDVSKNFLSGSSLKADSALTDVVWCHKSFDNKILTSARNGDLILWDLNKSGSLKYERKTKGHTRSINKLSYSSSLPNLCCTGSSDGLLKVWDLRDLTKASHYVSNQFAVRTMLFTPSAAEPFAAISALDNGTICRWDLRMGQRGQLERIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.47
3 0.52
4 0.59
5 0.66
6 0.73
7 0.79
8 0.87
9 0.85
10 0.83
11 0.84
12 0.83
13 0.82
14 0.75
15 0.66
16 0.61
17 0.53
18 0.46
19 0.38
20 0.32
21 0.25
22 0.26
23 0.26
24 0.22
25 0.21
26 0.2
27 0.19
28 0.16
29 0.16
30 0.14
31 0.17
32 0.17
33 0.18
34 0.2
35 0.23
36 0.27
37 0.28
38 0.27
39 0.24
40 0.27
41 0.25
42 0.21
43 0.21
44 0.18
45 0.2
46 0.19
47 0.19
48 0.17
49 0.18
50 0.17
51 0.17
52 0.17
53 0.16
54 0.19
55 0.21
56 0.22
57 0.24
58 0.23
59 0.21
60 0.26
61 0.26
62 0.23
63 0.21
64 0.19
65 0.2
66 0.2
67 0.23
68 0.18
69 0.17
70 0.17
71 0.18
72 0.18
73 0.15
74 0.16
75 0.16
76 0.18
77 0.21
78 0.19
79 0.18
80 0.18
81 0.17
82 0.18
83 0.16
84 0.15
85 0.13
86 0.13
87 0.12
88 0.12
89 0.12
90 0.1
91 0.1
92 0.09
93 0.06
94 0.05
95 0.06
96 0.08
97 0.09
98 0.09
99 0.1
100 0.12
101 0.16
102 0.17
103 0.23
104 0.25
105 0.24
106 0.27
107 0.28
108 0.26
109 0.24
110 0.26
111 0.2
112 0.16
113 0.16
114 0.13
115 0.1
116 0.11
117 0.1
118 0.08
119 0.07
120 0.07
121 0.07
122 0.08
123 0.08
124 0.07
125 0.1
126 0.16
127 0.2
128 0.24
129 0.34
130 0.37
131 0.39
132 0.46
133 0.52
134 0.55
135 0.61
136 0.66
137 0.63
138 0.69
139 0.72
140 0.69
141 0.61
142 0.52
143 0.44
144 0.39
145 0.35
146 0.27
147 0.25
148 0.24
149 0.23
150 0.24
151 0.23
152 0.2
153 0.17
154 0.19
155 0.18
156 0.16
157 0.16
158 0.16
159 0.16
160 0.16
161 0.16
162 0.13
163 0.11
164 0.11
165 0.12
166 0.12
167 0.12
168 0.16
169 0.17
170 0.18
171 0.19
172 0.21
173 0.21
174 0.25
175 0.25
176 0.25
177 0.26
178 0.29
179 0.26
180 0.25
181 0.24
182 0.21
183 0.2
184 0.18
185 0.16
186 0.15
187 0.14
188 0.14
189 0.15
190 0.15
191 0.16
192 0.14
193 0.13
194 0.11
195 0.11
196 0.11
197 0.09
198 0.07
199 0.06
200 0.09
201 0.09
202 0.09
203 0.08
204 0.09
205 0.1
206 0.11
207 0.11
208 0.1
209 0.11
210 0.13
211 0.2
212 0.28
213 0.36
214 0.37
215 0.42
216 0.47
217 0.5