Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UCY8

Protein Details
Accession A0A286UCY8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
27-50LRLNCLRSKSARKRRKQLVGRGMWHydrophilic
NLS Segment(s)
PositionSequence
36-42SARKRRK
Subcellular Location(s) plas 14, E.R. 4, mito 3, golg 3, extr 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFFHAYPARFDFIRAWALILFESFAFLRLNCLRSKSARKRRKQLVGRGMWLSESFNELGVLSLSADTGLIEGVFNSDRFRDRLGRSAELPYREESRLERLVVYFGIVLIGELSLEIELRQAMHFCVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.17
4 0.18
5 0.16
6 0.14
7 0.11
8 0.07
9 0.09
10 0.08
11 0.09
12 0.09
13 0.08
14 0.14
15 0.16
16 0.19
17 0.19
18 0.22
19 0.24
20 0.3
21 0.42
22 0.47
23 0.55
24 0.63
25 0.71
26 0.78
27 0.84
28 0.88
29 0.86
30 0.85
31 0.84
32 0.8
33 0.74
34 0.65
35 0.55
36 0.45
37 0.36
38 0.26
39 0.16
40 0.13
41 0.09
42 0.08
43 0.08
44 0.07
45 0.07
46 0.06
47 0.06
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.02
57 0.02
58 0.02
59 0.04
60 0.04
61 0.05
62 0.05
63 0.07
64 0.09
65 0.1
66 0.13
67 0.18
68 0.19
69 0.27
70 0.31
71 0.33
72 0.33
73 0.38
74 0.39
75 0.36
76 0.36
77 0.31
78 0.3
79 0.28
80 0.28
81 0.24
82 0.27
83 0.27
84 0.26
85 0.24
86 0.21
87 0.21
88 0.2
89 0.18
90 0.12
91 0.08
92 0.08
93 0.07
94 0.06
95 0.05
96 0.05
97 0.03
98 0.03
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.06
106 0.07
107 0.08