Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8BTG3

Protein Details
Accession G8BTG3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
62-83FTMPSSRYRKNRSQQKKTSDKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR020366  Ies5  
Gene Ontology GO:0031011  C:Ino80 complex  
KEGG tpf:TPHA_0E00970  -  
Pfam View protein in Pfam  
PF17335  IES5  
Amino Acid Sequences MNSEKQYQKLVSRHDELIKQDLTLRKEYTTLLRKCQSLFYYLNNDKLYNTRIIDKVNRSIGFTMPSSRYRKNRSQQKKTSDKLSKDENDENDSMAITKDEISSKVSELNPLEYLNAITNKGVVDRNKMITNKILKRKITDGSIKKLPDLKWYNDQLELVFEQLDDNTEEFELPEEIQNSYELYKTTPLLYNDIKDDIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.5
4 0.5
5 0.43
6 0.36
7 0.36
8 0.37
9 0.36
10 0.36
11 0.34
12 0.29
13 0.29
14 0.31
15 0.35
16 0.39
17 0.39
18 0.42
19 0.44
20 0.45
21 0.45
22 0.5
23 0.42
24 0.37
25 0.36
26 0.33
27 0.39
28 0.39
29 0.44
30 0.39
31 0.38
32 0.33
33 0.34
34 0.32
35 0.27
36 0.26
37 0.24
38 0.24
39 0.28
40 0.33
41 0.35
42 0.37
43 0.4
44 0.39
45 0.36
46 0.35
47 0.32
48 0.28
49 0.25
50 0.23
51 0.2
52 0.26
53 0.3
54 0.35
55 0.42
56 0.46
57 0.55
58 0.61
59 0.68
60 0.73
61 0.78
62 0.8
63 0.83
64 0.85
65 0.79
66 0.8
67 0.77
68 0.69
69 0.63
70 0.62
71 0.55
72 0.51
73 0.52
74 0.44
75 0.4
76 0.36
77 0.32
78 0.24
79 0.21
80 0.15
81 0.11
82 0.09
83 0.05
84 0.05
85 0.06
86 0.06
87 0.07
88 0.08
89 0.09
90 0.09
91 0.13
92 0.13
93 0.15
94 0.15
95 0.16
96 0.15
97 0.14
98 0.14
99 0.1
100 0.11
101 0.1
102 0.1
103 0.09
104 0.08
105 0.08
106 0.08
107 0.1
108 0.13
109 0.12
110 0.17
111 0.19
112 0.22
113 0.26
114 0.27
115 0.27
116 0.3
117 0.37
118 0.4
119 0.47
120 0.51
121 0.48
122 0.51
123 0.54
124 0.51
125 0.48
126 0.5
127 0.46
128 0.46
129 0.51
130 0.47
131 0.46
132 0.48
133 0.42
134 0.43
135 0.43
136 0.41
137 0.43
138 0.47
139 0.47
140 0.43
141 0.42
142 0.32
143 0.3
144 0.25
145 0.18
146 0.13
147 0.1
148 0.09
149 0.09
150 0.1
151 0.08
152 0.08
153 0.08
154 0.09
155 0.09
156 0.08
157 0.1
158 0.1
159 0.09
160 0.12
161 0.12
162 0.12
163 0.13
164 0.13
165 0.13
166 0.13
167 0.14
168 0.11
169 0.12
170 0.15
171 0.16
172 0.18
173 0.23
174 0.24
175 0.29
176 0.32
177 0.33
178 0.33