Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A541AXS1

Protein Details
Accession A0A541AXS1   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
185-205ITLSNKKRYKGWRVFRYKFIIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 12.333, nucl 7, cyto_nucl 4.833
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
Amino Acid Sequences MSYNKYSHWGFLRVKPLKLDYTITNHHGVNNKPLCSDYLLMLVRLIRPVTNKNDDKLVDLLNSLRNNVNVEELKDNSIFRLKEDLKPTDFINRYHDLTKDPKYHSFANLMEISLNIAKVRLSQAEDSRHVFKNIMRLSGYDLSMDRISTHKSIYLIAHFTTADISSWSDFESVKQEFGILRKCFITLSNKKRYKGWRVFRYKFIITYWCKLGCYWWIYKNIGLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.53
4 0.48
5 0.46
6 0.43
7 0.36
8 0.38
9 0.41
10 0.4
11 0.39
12 0.35
13 0.36
14 0.39
15 0.37
16 0.4
17 0.4
18 0.38
19 0.35
20 0.36
21 0.33
22 0.31
23 0.3
24 0.2
25 0.21
26 0.21
27 0.21
28 0.21
29 0.2
30 0.17
31 0.18
32 0.17
33 0.12
34 0.15
35 0.21
36 0.27
37 0.36
38 0.37
39 0.37
40 0.42
41 0.41
42 0.4
43 0.37
44 0.31
45 0.22
46 0.2
47 0.2
48 0.2
49 0.2
50 0.18
51 0.17
52 0.17
53 0.18
54 0.18
55 0.21
56 0.16
57 0.18
58 0.19
59 0.19
60 0.21
61 0.2
62 0.19
63 0.16
64 0.2
65 0.18
66 0.16
67 0.24
68 0.23
69 0.28
70 0.34
71 0.36
72 0.33
73 0.34
74 0.34
75 0.34
76 0.34
77 0.29
78 0.3
79 0.29
80 0.29
81 0.29
82 0.29
83 0.24
84 0.27
85 0.32
86 0.33
87 0.33
88 0.35
89 0.37
90 0.38
91 0.36
92 0.34
93 0.28
94 0.26
95 0.23
96 0.19
97 0.16
98 0.14
99 0.13
100 0.09
101 0.09
102 0.05
103 0.05
104 0.05
105 0.05
106 0.07
107 0.07
108 0.09
109 0.12
110 0.16
111 0.2
112 0.22
113 0.24
114 0.27
115 0.27
116 0.26
117 0.25
118 0.21
119 0.26
120 0.26
121 0.25
122 0.21
123 0.2
124 0.25
125 0.26
126 0.25
127 0.17
128 0.16
129 0.16
130 0.16
131 0.16
132 0.11
133 0.1
134 0.13
135 0.13
136 0.13
137 0.13
138 0.13
139 0.15
140 0.16
141 0.17
142 0.16
143 0.15
144 0.16
145 0.14
146 0.13
147 0.12
148 0.11
149 0.09
150 0.08
151 0.09
152 0.08
153 0.08
154 0.09
155 0.09
156 0.09
157 0.1
158 0.14
159 0.14
160 0.14
161 0.14
162 0.14
163 0.15
164 0.19
165 0.27
166 0.22
167 0.23
168 0.23
169 0.24
170 0.23
171 0.25
172 0.32
173 0.33
174 0.42
175 0.51
176 0.57
177 0.59
178 0.66
179 0.71
180 0.72
181 0.72
182 0.74
183 0.74
184 0.78
185 0.81
186 0.82
187 0.8
188 0.72
189 0.64
190 0.56
191 0.54
192 0.49
193 0.49
194 0.47
195 0.41
196 0.39
197 0.36
198 0.36
199 0.34
200 0.34
201 0.35
202 0.35
203 0.39
204 0.41