A0A286UUZ8

UniProt ID: A0A286UUZ8   Organism: Pyrrhoderma noxium
Gene: PNOK_0047500   Protein: Mitochondrial ribosomal of the small subunit
Length: 133 AA

Protein Details

• Accession: A0A286UUZ8
• Localization Confidence: Medium
• Confidence Score: 10.3
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  82-108	QEHKDRGKGAPKKAKTKADSRRSQKKR	Basic

• NLS Segment(s):

  Position	Sequence
  83-108	EHKDRGKGAPKKAKTKADSRRSQKKR

• Subcellular Location(s): mito 20, nucl 6
• Family & Domain DBs:
  • InterPro:
    • IPR013219 Ribosomal_S27/S33_mit
  • Gene Ontology:
    • GO:0005739 C:mitochondrion
    • GO:1990904 C:ribonucleoprotein complex
    • GO:0005840 C:ribosome
  • Pfam:
    • PF08293 MRP-S33
• Amino Acid Sequences: MAEVAPAVLKSLNRLRCSIFQTTFNPISRRNGAKYLKSRLRGPSMVEYYPPRDEMSITKLNTIYPGWNLVDIHEVRRKIAVQEHKDRGKGAPKKAKTKADSRRSQKKR

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.33
2, 0.36
3, 0.4
4, 0.45
5, 0.47
6, 0.41
7, 0.39
8, 0.4
9, 0.46
10, 0.47
11, 0.45
12, 0.43
13, 0.38
14, 0.41
15, 0.43
16, 0.44
17, 0.4
18, 0.43
19, 0.44
20, 0.5
21, 0.54
22, 0.58
23, 0.58
24, 0.57
25, 0.59
26, 0.55
27, 0.56
28, 0.49
29, 0.46
30, 0.43
31, 0.4
32, 0.37
33, 0.34
34, 0.31
35, 0.28
36, 0.28
37, 0.25
38, 0.18
39, 0.14
40, 0.15
41, 0.14
42, 0.18
43, 0.21
44, 0.2
45, 0.21
46, 0.2
47, 0.2
48, 0.21
49, 0.2
50, 0.15
51, 0.1
52, 0.12
53, 0.11
54, 0.12
55, 0.12
56, 0.11
57, 0.16
58, 0.15
59, 0.19
60, 0.21
61, 0.21
62, 0.21
63, 0.23
64, 0.23
65, 0.2
66, 0.28
67, 0.33
68, 0.37
69, 0.46
70, 0.54
71, 0.57
72, 0.57
73, 0.56
74, 0.53
75, 0.54
76, 0.53
77, 0.54
78, 0.56
79, 0.6
80, 0.68
81, 0.76
82, 0.8
83, 0.76
84, 0.79
85, 0.79
86, 0.79
87, 0.82
88, 0.82