Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UFU1

Protein Details
Accession A0A286UFU1    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
255-274AEEQERRRKRAERFGLNAKAHydrophilic
NLS Segment(s)
PositionSequence
146-215KRRKRAERFGIPLVAPKPVSPPKNEGKKVKPGAPKPAPQNTKVPARGPQRRGPANARSRAPAQPKIQAKA
224-233KRDARAKRFG
260-267RRRKRAER
Subcellular Location(s) nucl 19, cyto_nucl 12.333, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MESRLKALKVVDLKDILTRAGESAVKGNKPDLITKIIGSPAALQIYEDLYGSEKKSGASTPKPAPTPAPVPPASEAAVKETDKVETYELNNAETTDKPPATETVPAENLSASKETPTATTESGANPAEEKTEAKTEETVVDEEELKRRKRAERFGIPLVAPKPVSPPKNEGKKVKPGAPKPAPQNTKVPARGPQRRGPANARSRAPAQPKIQAKAALPVEDDSKRDARAKRFGIESKPNTAAGQKRGPPAENIDAEEQERRRKRAERFGLNAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.26
4 0.21
5 0.19
6 0.15
7 0.16
8 0.16
9 0.14
10 0.2
11 0.25
12 0.26
13 0.26
14 0.27
15 0.28
16 0.29
17 0.32
18 0.28
19 0.28
20 0.27
21 0.27
22 0.28
23 0.25
24 0.23
25 0.2
26 0.18
27 0.16
28 0.16
29 0.15
30 0.12
31 0.12
32 0.12
33 0.12
34 0.1
35 0.08
36 0.09
37 0.11
38 0.12
39 0.14
40 0.13
41 0.13
42 0.15
43 0.18
44 0.23
45 0.27
46 0.33
47 0.37
48 0.42
49 0.44
50 0.43
51 0.42
52 0.4
53 0.39
54 0.37
55 0.37
56 0.32
57 0.33
58 0.33
59 0.33
60 0.29
61 0.26
62 0.22
63 0.18
64 0.21
65 0.19
66 0.19
67 0.17
68 0.17
69 0.16
70 0.17
71 0.15
72 0.13
73 0.15
74 0.19
75 0.19
76 0.19
77 0.18
78 0.17
79 0.18
80 0.16
81 0.17
82 0.16
83 0.16
84 0.15
85 0.16
86 0.17
87 0.17
88 0.2
89 0.19
90 0.18
91 0.2
92 0.2
93 0.19
94 0.18
95 0.16
96 0.13
97 0.13
98 0.08
99 0.08
100 0.08
101 0.08
102 0.09
103 0.1
104 0.11
105 0.1
106 0.11
107 0.11
108 0.11
109 0.13
110 0.13
111 0.11
112 0.1
113 0.1
114 0.1
115 0.09
116 0.09
117 0.08
118 0.11
119 0.11
120 0.12
121 0.12
122 0.12
123 0.12
124 0.13
125 0.11
126 0.09
127 0.09
128 0.09
129 0.09
130 0.14
131 0.19
132 0.19
133 0.21
134 0.25
135 0.31
136 0.38
137 0.46
138 0.5
139 0.53
140 0.58
141 0.58
142 0.57
143 0.5
144 0.47
145 0.38
146 0.31
147 0.22
148 0.17
149 0.2
150 0.24
151 0.26
152 0.24
153 0.3
154 0.37
155 0.47
156 0.52
157 0.53
158 0.53
159 0.61
160 0.63
161 0.64
162 0.64
163 0.59
164 0.64
165 0.63
166 0.63
167 0.6
168 0.66
169 0.62
170 0.56
171 0.58
172 0.52
173 0.54
174 0.51
175 0.46
176 0.44
177 0.51
178 0.57
179 0.56
180 0.59
181 0.59
182 0.6
183 0.63
184 0.62
185 0.62
186 0.62
187 0.63
188 0.58
189 0.53
190 0.52
191 0.54
192 0.54
193 0.52
194 0.46
195 0.48
196 0.51
197 0.51
198 0.51
199 0.47
200 0.41
201 0.41
202 0.4
203 0.33
204 0.28
205 0.26
206 0.27
207 0.25
208 0.25
209 0.22
210 0.22
211 0.23
212 0.29
213 0.34
214 0.37
215 0.45
216 0.48
217 0.48
218 0.52
219 0.55
220 0.57
221 0.61
222 0.58
223 0.55
224 0.54
225 0.5
226 0.45
227 0.45
228 0.43
229 0.39
230 0.44
231 0.42
232 0.46
233 0.5
234 0.5
235 0.47
236 0.48
237 0.49
238 0.43
239 0.41
240 0.38
241 0.35
242 0.35
243 0.39
244 0.36
245 0.39
246 0.43
247 0.44
248 0.48
249 0.55
250 0.62
251 0.66
252 0.73
253 0.73
254 0.74