Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UB51

Protein Details
Accession A0A286UB51   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKDCRRRNRKYRDINWDIRSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 10.5, mito 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022684  Calpain_cysteine_protease  
IPR038765  Papain-like_cys_pep_sf  
IPR000169  Pept_cys_AS  
IPR001300  Peptidase_C2_calpain_cat  
Gene Ontology GO:0004198  F:calcium-dependent cysteine-type endopeptidase activity  
GO:0003677  F:DNA binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00648  Peptidase_C2  
PROSITE View protein in PROSITE  
PS50203  CALPAIN_CAT  
PS00139  THIOL_PROTEASE_CYS  
Amino Acid Sequences MAKDCRRRNRKYRDINWDIRSDTHNCLNFPGDERSSYIIASDVLRVTDMFEKPSFYVNGAEASDIVQGDPGDCWFLSAMAAIATKPERL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.82
4 0.75
5 0.66
6 0.57
7 0.51
8 0.43
9 0.38
10 0.36
11 0.34
12 0.29
13 0.3
14 0.29
15 0.26
16 0.26
17 0.27
18 0.2
19 0.18
20 0.2
21 0.2
22 0.19
23 0.18
24 0.14
25 0.1
26 0.1
27 0.1
28 0.09
29 0.07
30 0.06
31 0.06
32 0.06
33 0.07
34 0.1
35 0.1
36 0.12
37 0.12
38 0.13
39 0.14
40 0.17
41 0.15
42 0.13
43 0.14
44 0.12
45 0.14
46 0.13
47 0.12
48 0.1
49 0.1
50 0.1
51 0.08
52 0.07
53 0.07
54 0.06
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.09
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.06
67 0.07
68 0.06
69 0.1