Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AKG8

Protein Details
Accession G3AKG8   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
41-62SLDSKFTKKSHKKSVVGRNYPNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7, cyto_nucl 6
Family & Domain DBs
KEGG spaa:SPAPADRAFT_60270  -  
Amino Acid Sequences MIKTYSRRNSLTSISTTTSAAPSASSTTISRHDLSTDNLVSLDSKFTKKSHKKSVVGRNYPNSPHIPHGFEMSSSKNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.3
4 0.26
5 0.22
6 0.18
7 0.14
8 0.1
9 0.09
10 0.1
11 0.1
12 0.11
13 0.1
14 0.12
15 0.15
16 0.18
17 0.18
18 0.16
19 0.17
20 0.17
21 0.18
22 0.2
23 0.17
24 0.14
25 0.13
26 0.13
27 0.12
28 0.11
29 0.11
30 0.09
31 0.1
32 0.12
33 0.14
34 0.25
35 0.33
36 0.42
37 0.5
38 0.58
39 0.64
40 0.71
41 0.81
42 0.81
43 0.8
44 0.78
45 0.74
46 0.7
47 0.66
48 0.6
49 0.53
50 0.45
51 0.43
52 0.4
53 0.37
54 0.33
55 0.35
56 0.32
57 0.29
58 0.3