Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UQ71

Protein Details
Accession A0A286UQ71    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-34LYAVHPNVTTRKRREKKEKVVSRETNEHydrophilic
NLS Segment(s)
PositionSequence
19-24KRREKK
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MARVIRKLYAVHPNVTTRKRREKKEKVVSRETNETNLNNKHTEQITREPPSDGSSTGTSLSSSQTSETRPSPSVINAQWTNVLKAITHGQVKTRSTSFRPPPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.57
4 0.56
5 0.64
6 0.69
7 0.76
8 0.8
9 0.83
10 0.87
11 0.89
12 0.9
13 0.87
14 0.89
15 0.85
16 0.79
17 0.76
18 0.67
19 0.59
20 0.53
21 0.46
22 0.42
23 0.38
24 0.35
25 0.29
26 0.28
27 0.28
28 0.26
29 0.26
30 0.24
31 0.27
32 0.32
33 0.33
34 0.33
35 0.3
36 0.29
37 0.3
38 0.26
39 0.2
40 0.16
41 0.13
42 0.13
43 0.13
44 0.12
45 0.1
46 0.09
47 0.1
48 0.08
49 0.08
50 0.09
51 0.1
52 0.12
53 0.15
54 0.16
55 0.18
56 0.19
57 0.2
58 0.2
59 0.2
60 0.24
61 0.22
62 0.27
63 0.24
64 0.24
65 0.28
66 0.28
67 0.27
68 0.23
69 0.23
70 0.16
71 0.18
72 0.21
73 0.2
74 0.23
75 0.23
76 0.27
77 0.33
78 0.35
79 0.38
80 0.38
81 0.39
82 0.4
83 0.5
84 0.53