Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UEL8

Protein Details
Accession A0A286UEL8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-35LSSPRRRERAARRCGPGHRQRRRQTPFFISHHydrophilic
NLS Segment(s)
PositionSequence
9-26RRRERAARRCGPGHRQRR
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
IPR039143  GNPNAT1  
Gene Ontology GO:0004343  F:glucosamine 6-phosphate N-acetyltransferase activity  
GO:0006048  P:UDP-N-acetylglucosamine biosynthetic process  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PROSITE View protein in PROSITE  
PS51186  GNAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MNAVLSSPRRRERAARRCGPGHRQRRRQTPFFISHRTPRMPLTQDSELDLLFPADRIPQEVKDALHEDLHIRPLASTDYRRGHLDVLSVLTVVTDPGEEAWVDQFRAQQAAPDTYYTIVVLERSTDRIVGVGCVFIERKFLRGLGKVGHIEDIAVDSRVQGKKIGLRIIDALTRISESAGCYKTILNCSDKNIPFYVKCGYEKKENEMAKYAKKDIPPPSPTTSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.73
3 0.73
4 0.77
5 0.8
6 0.81
7 0.8
8 0.81
9 0.81
10 0.83
11 0.84
12 0.88
13 0.89
14 0.85
15 0.83
16 0.81
17 0.8
18 0.76
19 0.75
20 0.69
21 0.69
22 0.69
23 0.64
24 0.56
25 0.5
26 0.51
27 0.47
28 0.45
29 0.44
30 0.4
31 0.38
32 0.38
33 0.35
34 0.27
35 0.23
36 0.2
37 0.13
38 0.09
39 0.08
40 0.06
41 0.07
42 0.08
43 0.11
44 0.13
45 0.13
46 0.17
47 0.19
48 0.19
49 0.2
50 0.23
51 0.2
52 0.18
53 0.18
54 0.16
55 0.16
56 0.18
57 0.15
58 0.12
59 0.11
60 0.11
61 0.14
62 0.15
63 0.16
64 0.2
65 0.23
66 0.25
67 0.26
68 0.26
69 0.25
70 0.22
71 0.21
72 0.15
73 0.13
74 0.11
75 0.1
76 0.08
77 0.07
78 0.06
79 0.05
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.06
88 0.06
89 0.07
90 0.07
91 0.08
92 0.08
93 0.1
94 0.09
95 0.1
96 0.11
97 0.12
98 0.12
99 0.11
100 0.11
101 0.11
102 0.11
103 0.09
104 0.07
105 0.05
106 0.05
107 0.05
108 0.06
109 0.06
110 0.08
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.07
118 0.06
119 0.05
120 0.06
121 0.07
122 0.06
123 0.12
124 0.11
125 0.12
126 0.13
127 0.14
128 0.16
129 0.18
130 0.2
131 0.17
132 0.2
133 0.2
134 0.2
135 0.19
136 0.16
137 0.14
138 0.12
139 0.11
140 0.08
141 0.08
142 0.07
143 0.07
144 0.13
145 0.15
146 0.15
147 0.15
148 0.17
149 0.21
150 0.25
151 0.29
152 0.23
153 0.23
154 0.25
155 0.25
156 0.24
157 0.2
158 0.17
159 0.13
160 0.13
161 0.12
162 0.1
163 0.09
164 0.1
165 0.15
166 0.16
167 0.16
168 0.16
169 0.18
170 0.22
171 0.25
172 0.27
173 0.26
174 0.27
175 0.32
176 0.41
177 0.41
178 0.4
179 0.38
180 0.39
181 0.34
182 0.35
183 0.35
184 0.3
185 0.34
186 0.36
187 0.38
188 0.44
189 0.46
190 0.51
191 0.55
192 0.53
193 0.52
194 0.54
195 0.55
196 0.54
197 0.56
198 0.55
199 0.5
200 0.52
201 0.56
202 0.56
203 0.6
204 0.57
205 0.58
206 0.6