Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286U7X2

Protein Details
Accession A0A286U7X2    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
228-273NSTPNVDKATRKKRKNIEDTTEEVHVEKGKAPRNNKGRKKVRFENLHydrophilic
NLS Segment(s)
PositionSequence
255-269KGKAPRNNKGRKKVR
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MSTHQADPEIRIPNKTKDECNILATLRDPKRINGEPPKYLEFKDCDGNAIKASCAAEGKSNLNKPDRSISGMKIFKNIDVLEITCNNKEPFELFQAGIVIGAALTVEMLLNRLAIEIRKYIDYVRHVKLLNEEIERVNKRKSGGSEENKVPEKSEGQKKNEKESKIDDVKIWGIREKSFKKWEVFLSKVDKVDKVESPVPRPEYVSLQDLILNPKLYRPHGQVDTDLNSTPNVDKATRKKRKNIEDTTEEVHVEKGKAPRNNKGRKKVRFENL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.54
4 0.51
5 0.58
6 0.54
7 0.52
8 0.47
9 0.38
10 0.35
11 0.33
12 0.37
13 0.33
14 0.38
15 0.36
16 0.35
17 0.43
18 0.47
19 0.53
20 0.54
21 0.58
22 0.56
23 0.6
24 0.62
25 0.56
26 0.52
27 0.48
28 0.41
29 0.37
30 0.38
31 0.33
32 0.32
33 0.32
34 0.32
35 0.29
36 0.26
37 0.23
38 0.18
39 0.19
40 0.16
41 0.14
42 0.14
43 0.15
44 0.17
45 0.23
46 0.27
47 0.31
48 0.35
49 0.4
50 0.4
51 0.39
52 0.42
53 0.39
54 0.38
55 0.37
56 0.35
57 0.39
58 0.42
59 0.4
60 0.38
61 0.37
62 0.32
63 0.33
64 0.29
65 0.21
66 0.18
67 0.18
68 0.16
69 0.18
70 0.2
71 0.17
72 0.19
73 0.18
74 0.17
75 0.16
76 0.15
77 0.14
78 0.17
79 0.18
80 0.15
81 0.16
82 0.16
83 0.15
84 0.13
85 0.11
86 0.06
87 0.03
88 0.03
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.03
96 0.03
97 0.03
98 0.03
99 0.04
100 0.04
101 0.05
102 0.07
103 0.07
104 0.08
105 0.09
106 0.09
107 0.1
108 0.14
109 0.19
110 0.23
111 0.23
112 0.26
113 0.26
114 0.26
115 0.28
116 0.28
117 0.25
118 0.21
119 0.2
120 0.17
121 0.22
122 0.24
123 0.23
124 0.22
125 0.21
126 0.21
127 0.23
128 0.24
129 0.27
130 0.34
131 0.38
132 0.42
133 0.42
134 0.46
135 0.46
136 0.44
137 0.36
138 0.28
139 0.27
140 0.28
141 0.35
142 0.38
143 0.4
144 0.48
145 0.49
146 0.58
147 0.61
148 0.55
149 0.49
150 0.47
151 0.5
152 0.47
153 0.46
154 0.36
155 0.33
156 0.35
157 0.33
158 0.29
159 0.23
160 0.2
161 0.22
162 0.3
163 0.31
164 0.35
165 0.39
166 0.43
167 0.42
168 0.44
169 0.49
170 0.47
171 0.46
172 0.44
173 0.44
174 0.42
175 0.43
176 0.41
177 0.36
178 0.31
179 0.33
180 0.29
181 0.28
182 0.31
183 0.31
184 0.33
185 0.38
186 0.38
187 0.35
188 0.35
189 0.32
190 0.31
191 0.3
192 0.29
193 0.23
194 0.2
195 0.22
196 0.21
197 0.23
198 0.21
199 0.2
200 0.17
201 0.2
202 0.24
203 0.25
204 0.29
205 0.3
206 0.34
207 0.37
208 0.39
209 0.39
210 0.4
211 0.4
212 0.37
213 0.33
214 0.26
215 0.22
216 0.22
217 0.19
218 0.17
219 0.16
220 0.17
221 0.24
222 0.34
223 0.45
224 0.54
225 0.61
226 0.68
227 0.75
228 0.84
229 0.86
230 0.86
231 0.84
232 0.8
233 0.77
234 0.71
235 0.63
236 0.52
237 0.42
238 0.35
239 0.28
240 0.23
241 0.24
242 0.27
243 0.33
244 0.4
245 0.45
246 0.53
247 0.61
248 0.71
249 0.76
250 0.8
251 0.82
252 0.85
253 0.89