Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A286UGL1

Protein Details
Accession A0A286UGL1   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
80-100TASVLWIHKHHKRNQIRQNKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 7, nucl 3, cyto_nucl 3, pero 3, extr 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQVTGPGRVEYPLFIKYPPAVTRHIPLVKLDIAPPPFRSFELENDLTRSYFRRGFNRDWPPQIIKSSYHIVIVGVAPAGTASVLWIHKHHKRNQIRQNKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.24
5 0.25
6 0.24
7 0.25
8 0.27
9 0.29
10 0.35
11 0.36
12 0.31
13 0.29
14 0.3
15 0.28
16 0.26
17 0.24
18 0.21
19 0.21
20 0.22
21 0.23
22 0.22
23 0.21
24 0.21
25 0.23
26 0.2
27 0.2
28 0.26
29 0.26
30 0.24
31 0.25
32 0.25
33 0.21
34 0.2
35 0.19
36 0.15
37 0.18
38 0.21
39 0.25
40 0.3
41 0.35
42 0.44
43 0.51
44 0.53
45 0.51
46 0.52
47 0.49
48 0.46
49 0.44
50 0.37
51 0.29
52 0.28
53 0.28
54 0.25
55 0.21
56 0.19
57 0.16
58 0.15
59 0.14
60 0.1
61 0.06
62 0.06
63 0.05
64 0.04
65 0.04
66 0.03
67 0.03
68 0.03
69 0.06
70 0.08
71 0.1
72 0.13
73 0.2
74 0.29
75 0.38
76 0.46
77 0.53
78 0.63
79 0.73
80 0.81