Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A541AXP0

Protein Details
Accession A0A541AXP0    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-24PLLVGTCKKKRYTKVNPDSGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027434  Homing_endonucl  
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences MGIPLLVGTCKKKRYTKVNPDSGVLNTTKYLDYLDYLDYLDYLEYLDYLDYLDYLEYLDYLDYLNWKEVFFKLKNYSNLPKEFVRSKILTIKAGMNDQRTNFVYPHNFQVNITPYWLLGFIEGDGHFGLRAKEHIRYFSLEQTHLQRYTLNRVKMYFEGLDSNLLYDSRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.72
3 0.77
4 0.81
5 0.85
6 0.79
7 0.73
8 0.66
9 0.57
10 0.49
11 0.38
12 0.29
13 0.19
14 0.19
15 0.17
16 0.15
17 0.14
18 0.11
19 0.12
20 0.12
21 0.12
22 0.11
23 0.11
24 0.11
25 0.1
26 0.09
27 0.08
28 0.06
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.06
50 0.06
51 0.09
52 0.09
53 0.09
54 0.1
55 0.12
56 0.18
57 0.17
58 0.21
59 0.25
60 0.3
61 0.33
62 0.37
63 0.43
64 0.42
65 0.43
66 0.41
67 0.37
68 0.34
69 0.34
70 0.31
71 0.29
72 0.24
73 0.24
74 0.27
75 0.27
76 0.25
77 0.24
78 0.23
79 0.2
80 0.23
81 0.23
82 0.2
83 0.21
84 0.2
85 0.23
86 0.22
87 0.23
88 0.2
89 0.21
90 0.22
91 0.21
92 0.27
93 0.25
94 0.24
95 0.22
96 0.27
97 0.27
98 0.24
99 0.23
100 0.18
101 0.15
102 0.15
103 0.15
104 0.1
105 0.07
106 0.06
107 0.05
108 0.07
109 0.07
110 0.08
111 0.08
112 0.08
113 0.07
114 0.08
115 0.09
116 0.07
117 0.11
118 0.12
119 0.19
120 0.21
121 0.24
122 0.25
123 0.29
124 0.31
125 0.34
126 0.35
127 0.31
128 0.32
129 0.35
130 0.39
131 0.35
132 0.33
133 0.3
134 0.3
135 0.39
136 0.43
137 0.42
138 0.4
139 0.41
140 0.45
141 0.42
142 0.44
143 0.34
144 0.28
145 0.27
146 0.24
147 0.26
148 0.21
149 0.21
150 0.17