Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286UIK0

Protein Details
Accession A0A286UIK0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-72ATPTVPAKRPRGRPRKHFVRIPLESHydrophilic
NLS Segment(s)
PositionSequence
54-63AKRPRGRPRK
Subcellular Location(s) mito 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MQGTAVPMSISASSFYGVPSGMNAGTTSATVVNGGGVSGGAGVGGATATPTVPAKRPRGRPRKHFVRIPLESLMTPIIPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.07
6 0.06
7 0.07
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.06
16 0.06
17 0.06
18 0.05
19 0.05
20 0.04
21 0.04
22 0.03
23 0.03
24 0.03
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.03
37 0.05
38 0.06
39 0.12
40 0.18
41 0.27
42 0.36
43 0.46
44 0.57
45 0.67
46 0.75
47 0.8
48 0.84
49 0.86
50 0.87
51 0.83
52 0.82
53 0.81
54 0.75
55 0.7
56 0.63
57 0.54
58 0.45
59 0.4
60 0.32