Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A286U883

Protein Details
Accession A0A286U883    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-26PTILSTKQYKKEEKPRPENIPGCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MRIPTILSTKQYKKEEKPRPENIPGCKFHKSTTPSPVLILNPSSKETLQVYLFPFPYPKYPGLHQHQHQHPNPDTEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.79
4 0.82
5 0.82
6 0.82
7 0.83
8 0.8
9 0.77
10 0.75
11 0.69
12 0.64
13 0.6
14 0.53
15 0.45
16 0.46
17 0.43
18 0.4
19 0.42
20 0.42
21 0.37
22 0.37
23 0.37
24 0.3
25 0.25
26 0.22
27 0.16
28 0.13
29 0.14
30 0.14
31 0.13
32 0.14
33 0.14
34 0.15
35 0.15
36 0.16
37 0.17
38 0.19
39 0.2
40 0.19
41 0.19
42 0.17
43 0.21
44 0.22
45 0.22
46 0.22
47 0.26
48 0.35
49 0.42
50 0.5
51 0.51
52 0.57
53 0.64
54 0.7
55 0.71
56 0.71
57 0.67