Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8C1T6

Protein Details
Accession G8C1T6   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
72-100ENDPLKLRRKELRRKNRANIKQNNFLKQIHydrophilic
NLS Segment(s)
PositionSequence
77-88KLRRKELRRKNR
Subcellular Location(s) mito 18.5, mito_nucl 13.833, nucl 8, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG tpf:TPHA_0O01470  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MISVFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQAARLENDPLKLRRKELRRKNRANIKQNNFLKQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.29
4 0.28
5 0.26
6 0.23
7 0.23
8 0.22
9 0.18
10 0.16
11 0.15
12 0.16
13 0.16
14 0.19
15 0.17
16 0.14
17 0.16
18 0.18
19 0.24
20 0.26
21 0.26
22 0.29
23 0.31
24 0.3
25 0.31
26 0.3
27 0.23
28 0.2
29 0.21
30 0.15
31 0.14
32 0.13
33 0.12
34 0.14
35 0.13
36 0.14
37 0.14
38 0.15
39 0.14
40 0.14
41 0.12
42 0.09
43 0.09
44 0.09
45 0.06
46 0.06
47 0.08
48 0.09
49 0.11
50 0.11
51 0.12
52 0.13
53 0.15
54 0.14
55 0.13
56 0.12
57 0.12
58 0.14
59 0.14
60 0.17
61 0.21
62 0.25
63 0.32
64 0.33
65 0.37
66 0.44
67 0.53
68 0.61
69 0.66
70 0.73
71 0.76
72 0.84
73 0.89
74 0.92
75 0.92
76 0.92
77 0.92
78 0.88
79 0.88
80 0.85