Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BZD6

Protein Details
Accession G8BZD6   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-42AAMAGGKKSKKKWSKKSHKDKAQHAVILHydrophilic
NLS Segment(s)
PositionSequence
11-35AKAAAAMAGGKKSKKKWSKKSHKDK
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG tpf:TPHA_0F00950  -  
tpf:TPHA_0K01310  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKQQISKAAKAAAAMAGGKKSKKKWSKKSHKDKAQHAVILDQEKYDRIMKEVPTFRYVSVSVLVERLKLGGSMARVALRDLEAKGIIKPVSKHSKQAIYTRATASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.17
4 0.14
5 0.15
6 0.17
7 0.21
8 0.25
9 0.3
10 0.39
11 0.48
12 0.57
13 0.65
14 0.73
15 0.82
16 0.87
17 0.93
18 0.94
19 0.94
20 0.91
21 0.89
22 0.87
23 0.81
24 0.71
25 0.6
26 0.51
27 0.44
28 0.38
29 0.3
30 0.2
31 0.15
32 0.13
33 0.15
34 0.16
35 0.13
36 0.12
37 0.15
38 0.16
39 0.23
40 0.27
41 0.27
42 0.27
43 0.28
44 0.26
45 0.25
46 0.24
47 0.17
48 0.14
49 0.13
50 0.11
51 0.12
52 0.12
53 0.1
54 0.1
55 0.09
56 0.07
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.11
67 0.11
68 0.12
69 0.11
70 0.12
71 0.12
72 0.13
73 0.13
74 0.16
75 0.16
76 0.18
77 0.19
78 0.27
79 0.36
80 0.37
81 0.43
82 0.46
83 0.54
84 0.55
85 0.61
86 0.59
87 0.54
88 0.56