Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BQL7

Protein Details
Accession G8BQL7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
118-146RTNMDGLVKKKKKKRSTKTALKSKKSVKNHydrophilic
NLS Segment(s)
PositionSequence
126-146KKKKKKRSTKTALKSKKSVKN
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG tpf:TPHA_0C03770  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MVNSGCLSSEDFLLKVAEYFKISNERNIAVRLTLKRLVEHDEVELKPEYDVTNQPAYDVSTQAQSLSVTSIKPNNNDREYSLLVRASYGSHKGKNKCSTIISAGSLDKFWQDYSSVVRTNMDGLVKKKKKKRSTKTALKSKKSVKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.12
5 0.13
6 0.13
7 0.15
8 0.24
9 0.25
10 0.28
11 0.3
12 0.3
13 0.3
14 0.31
15 0.29
16 0.23
17 0.28
18 0.25
19 0.27
20 0.29
21 0.28
22 0.28
23 0.29
24 0.33
25 0.29
26 0.28
27 0.25
28 0.26
29 0.25
30 0.27
31 0.25
32 0.19
33 0.17
34 0.17
35 0.15
36 0.12
37 0.14
38 0.15
39 0.18
40 0.17
41 0.17
42 0.17
43 0.18
44 0.16
45 0.15
46 0.12
47 0.1
48 0.1
49 0.09
50 0.09
51 0.08
52 0.07
53 0.07
54 0.08
55 0.07
56 0.08
57 0.13
58 0.14
59 0.18
60 0.23
61 0.28
62 0.29
63 0.3
64 0.3
65 0.29
66 0.3
67 0.27
68 0.24
69 0.18
70 0.16
71 0.16
72 0.15
73 0.12
74 0.11
75 0.16
76 0.18
77 0.22
78 0.3
79 0.34
80 0.43
81 0.49
82 0.49
83 0.47
84 0.46
85 0.43
86 0.4
87 0.37
88 0.3
89 0.25
90 0.23
91 0.2
92 0.18
93 0.15
94 0.12
95 0.11
96 0.1
97 0.09
98 0.09
99 0.1
100 0.14
101 0.19
102 0.2
103 0.2
104 0.2
105 0.2
106 0.2
107 0.22
108 0.2
109 0.2
110 0.23
111 0.34
112 0.41
113 0.5
114 0.57
115 0.65
116 0.72
117 0.79
118 0.85
119 0.85
120 0.89
121 0.91
122 0.94
123 0.95
124 0.95
125 0.91
126 0.9