Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7REM5

Protein Details
Accession A0A1X7REM5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-75TPKVEPQEKKKTPKGRAKKRLTYVRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
39-65AGKVKAQTPKVEPQEKKKTPKGRAKKR
Subcellular Location(s) mito 11, nucl 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MPRLTRPTPLQRRSHHPAKLTETRQTAIMGKVHGSLARAGKVKAQTPKVEPQEKKKTPKGRAKKRLTYVRRFVNVTMTGGKRKMNPNPGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.72
3 0.67
4 0.65
5 0.65
6 0.68
7 0.63
8 0.61
9 0.55
10 0.5
11 0.45
12 0.4
13 0.34
14 0.27
15 0.25
16 0.18
17 0.16
18 0.16
19 0.15
20 0.14
21 0.13
22 0.13
23 0.13
24 0.16
25 0.16
26 0.15
27 0.18
28 0.2
29 0.24
30 0.26
31 0.29
32 0.28
33 0.3
34 0.38
35 0.41
36 0.48
37 0.46
38 0.5
39 0.58
40 0.62
41 0.66
42 0.67
43 0.69
44 0.7
45 0.79
46 0.8
47 0.8
48 0.84
49 0.87
50 0.87
51 0.87
52 0.89
53 0.87
54 0.86
55 0.83
56 0.81
57 0.75
58 0.69
59 0.6
60 0.56
61 0.49
62 0.42
63 0.4
64 0.34
65 0.35
66 0.35
67 0.37
68 0.36
69 0.42
70 0.49
71 0.52