Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7RVE1

Protein Details
Accession A0A1X7RVE1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-33DQYLQVPKRLHNRKARSKSRERASEIMHydrophilic
NLS Segment(s)
PositionSequence
17-26HNRKARSKSR
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
Amino Acid Sequences MTTRQSDQYLQVPKRLHNRKARSKSRERASEIMTGHVDIPSDSQVIVSPQKLSFRSRSPPLPIRPEPFRRAASYNNLENPSQTNGAESPLAVQPIYTPPCPLRVTTLTTPPSKSPKSPYQPFSPPPLSPPLTPLQPPTSPSNPPQPSAPSSSEPGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.62
4 0.63
5 0.71
6 0.76
7 0.84
8 0.88
9 0.88
10 0.89
11 0.9
12 0.89
13 0.87
14 0.83
15 0.77
16 0.7
17 0.66
18 0.56
19 0.5
20 0.4
21 0.32
22 0.26
23 0.21
24 0.17
25 0.11
26 0.12
27 0.09
28 0.09
29 0.08
30 0.07
31 0.07
32 0.1
33 0.12
34 0.11
35 0.12
36 0.13
37 0.18
38 0.19
39 0.23
40 0.24
41 0.27
42 0.32
43 0.35
44 0.38
45 0.41
46 0.47
47 0.49
48 0.54
49 0.53
50 0.52
51 0.55
52 0.56
53 0.53
54 0.5
55 0.46
56 0.41
57 0.39
58 0.38
59 0.38
60 0.36
61 0.35
62 0.34
63 0.33
64 0.3
65 0.28
66 0.26
67 0.21
68 0.17
69 0.15
70 0.12
71 0.1
72 0.11
73 0.11
74 0.09
75 0.09
76 0.08
77 0.09
78 0.08
79 0.07
80 0.07
81 0.12
82 0.15
83 0.13
84 0.14
85 0.15
86 0.2
87 0.21
88 0.21
89 0.21
90 0.21
91 0.27
92 0.28
93 0.35
94 0.34
95 0.35
96 0.37
97 0.35
98 0.4
99 0.37
100 0.38
101 0.38
102 0.44
103 0.52
104 0.58
105 0.58
106 0.59
107 0.63
108 0.63
109 0.64
110 0.58
111 0.49
112 0.44
113 0.47
114 0.43
115 0.35
116 0.36
117 0.33
118 0.31
119 0.32
120 0.34
121 0.32
122 0.31
123 0.34
124 0.37
125 0.37
126 0.38
127 0.41
128 0.47
129 0.45
130 0.44
131 0.45
132 0.43
133 0.43
134 0.45
135 0.45
136 0.38