Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7RZV6

Protein Details
Accession A0A1X7RZV6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-54VSLFKDGKLKNRNKHKKSPPPPPPPPKKKAVPVKKGPRCSEBasic
NLS Segment(s)
PositionSequence
18-50KDGKLKNRNKHKKSPPPPPPPPKKKAVPVKKGP
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
Amino Acid Sequences MARSWHTGRKKSDVSLFKDGKLKNRNKHKKSPPPPPPPPKKKAVPVKKGPRCSECLRGHRYCDGARPCGRCIHVGRPEDCVDQGVPLPSAGSNSTNNASGSGNTGAGNTGGGTTGAGNTGAANSSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.61
4 0.56
5 0.59
6 0.55
7 0.55
8 0.58
9 0.59
10 0.58
11 0.68
12 0.76
13 0.76
14 0.85
15 0.87
16 0.88
17 0.88
18 0.9
19 0.89
20 0.89
21 0.91
22 0.91
23 0.92
24 0.9
25 0.86
26 0.82
27 0.78
28 0.77
29 0.77
30 0.77
31 0.76
32 0.76
33 0.82
34 0.82
35 0.84
36 0.79
37 0.72
38 0.67
39 0.62
40 0.61
41 0.58
42 0.57
43 0.56
44 0.54
45 0.52
46 0.49
47 0.47
48 0.38
49 0.37
50 0.33
51 0.31
52 0.33
53 0.33
54 0.33
55 0.33
56 0.34
57 0.3
58 0.31
59 0.33
60 0.36
61 0.38
62 0.38
63 0.38
64 0.39
65 0.36
66 0.32
67 0.25
68 0.18
69 0.14
70 0.14
71 0.11
72 0.09
73 0.08
74 0.08
75 0.07
76 0.08
77 0.09
78 0.1
79 0.1
80 0.13
81 0.14
82 0.16
83 0.16
84 0.16
85 0.15
86 0.13
87 0.15
88 0.14
89 0.14
90 0.12
91 0.12
92 0.11
93 0.1
94 0.1
95 0.07
96 0.06
97 0.05
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.07