Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8BVY3

Protein Details
Accession G8BVY3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
15-42LLWKNPWRMSRPQKQRLRNRLKAVDKNIHydrophilic
104-123KKSPGYRKSVHKVPKWTKLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG tpf:TPHA_0G02250  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKPTNSLLGGLLWKNPWRMSRPQKQRLRNRLKAVDKNISELTLGLHLKTCESKGISYQEGLKMKTLFEPNNRLLQSLNDSSIFPKEHEMSPKDKYTVFNKKSPGYRKSVHKVPKWTKLSLRTNPEGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.21
5 0.23
6 0.26
7 0.28
8 0.3
9 0.39
10 0.47
11 0.55
12 0.63
13 0.71
14 0.77
15 0.83
16 0.88
17 0.89
18 0.9
19 0.88
20 0.86
21 0.85
22 0.85
23 0.83
24 0.79
25 0.77
26 0.66
27 0.62
28 0.53
29 0.44
30 0.34
31 0.26
32 0.2
33 0.15
34 0.15
35 0.11
36 0.12
37 0.11
38 0.12
39 0.13
40 0.13
41 0.11
42 0.12
43 0.12
44 0.14
45 0.17
46 0.17
47 0.17
48 0.18
49 0.21
50 0.22
51 0.22
52 0.21
53 0.18
54 0.17
55 0.2
56 0.22
57 0.2
58 0.21
59 0.27
60 0.27
61 0.33
62 0.33
63 0.3
64 0.26
65 0.25
66 0.26
67 0.21
68 0.21
69 0.15
70 0.15
71 0.16
72 0.18
73 0.18
74 0.13
75 0.15
76 0.16
77 0.19
78 0.25
79 0.27
80 0.29
81 0.33
82 0.35
83 0.34
84 0.33
85 0.34
86 0.37
87 0.45
88 0.45
89 0.46
90 0.48
91 0.52
92 0.59
93 0.64
94 0.6
95 0.56
96 0.59
97 0.63
98 0.66
99 0.7
100 0.71
101 0.7
102 0.75
103 0.77
104 0.8
105 0.76
106 0.74
107 0.72
108 0.73
109 0.75
110 0.73
111 0.73