Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7RTN9

Protein Details
Accession A0A1X7RTN9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-24TLVIWRQSKPNERRKPGLRELYEHydrophilic
NLS Segment(s)
PositionSequence
14-20RRKPGLR
28-33AKSAKK
Subcellular Location(s) nucl 19, mito_nucl 13.666, cyto_nucl 11.666, mito 6
Family & Domain DBs
Amino Acid Sequences MTLVIWRQSKPNERRKPGLRELYEKIAAKSAKKLGRTIAEIRAISHPTTKKDDKWVRIQHHMTMNWFYKSTDTASSDGIASSTRSGKQGHCFVDGENVTRMLSSSELDDNTKTADSSAQNVGSNPHTWYLAPPDENSRKRLTYKANEGYANIDCSTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.84
4 0.83
5 0.83
6 0.78
7 0.74
8 0.72
9 0.69
10 0.66
11 0.58
12 0.49
13 0.45
14 0.41
15 0.36
16 0.37
17 0.39
18 0.37
19 0.38
20 0.39
21 0.38
22 0.4
23 0.43
24 0.41
25 0.39
26 0.4
27 0.37
28 0.37
29 0.36
30 0.33
31 0.28
32 0.31
33 0.28
34 0.26
35 0.34
36 0.35
37 0.34
38 0.43
39 0.5
40 0.49
41 0.56
42 0.61
43 0.58
44 0.64
45 0.63
46 0.57
47 0.56
48 0.52
49 0.44
50 0.41
51 0.38
52 0.3
53 0.29
54 0.24
55 0.18
56 0.18
57 0.17
58 0.15
59 0.14
60 0.14
61 0.14
62 0.14
63 0.14
64 0.12
65 0.11
66 0.08
67 0.06
68 0.06
69 0.08
70 0.08
71 0.1
72 0.12
73 0.14
74 0.19
75 0.24
76 0.25
77 0.26
78 0.25
79 0.24
80 0.29
81 0.27
82 0.24
83 0.19
84 0.18
85 0.15
86 0.14
87 0.14
88 0.08
89 0.08
90 0.07
91 0.08
92 0.09
93 0.1
94 0.11
95 0.12
96 0.11
97 0.12
98 0.12
99 0.1
100 0.09
101 0.12
102 0.11
103 0.15
104 0.17
105 0.18
106 0.18
107 0.19
108 0.21
109 0.19
110 0.2
111 0.18
112 0.16
113 0.15
114 0.14
115 0.16
116 0.2
117 0.23
118 0.23
119 0.23
120 0.32
121 0.41
122 0.44
123 0.46
124 0.45
125 0.44
126 0.46
127 0.52
128 0.52
129 0.52
130 0.6
131 0.64
132 0.63
133 0.61
134 0.58
135 0.55
136 0.48
137 0.41