Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7S7D4

Protein Details
Accession A0A1X7S7D4    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
62-94ILRHDGRHRRCQARRARRRRAAGPTTRGRRPRRBasic
NLS Segment(s)
PositionSequence
68-94RHRRCQARRARRRRAAGPTTRGRRPRR
Subcellular Location(s) nucl 8, mito 7, extr 7, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MSEVLLWNHMNSGALFTIVASSITFTSTTTPLTAPSNPARYLSNPLPLPTPYLLLLINLRHILRHDGRHRRCQARRARRRRAAGPTTRGRRPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.07
6 0.08
7 0.05
8 0.06
9 0.06
10 0.07
11 0.07
12 0.07
13 0.09
14 0.09
15 0.1
16 0.1
17 0.1
18 0.11
19 0.14
20 0.14
21 0.16
22 0.2
23 0.23
24 0.22
25 0.23
26 0.23
27 0.22
28 0.28
29 0.25
30 0.27
31 0.23
32 0.23
33 0.24
34 0.22
35 0.23
36 0.17
37 0.16
38 0.11
39 0.11
40 0.11
41 0.1
42 0.11
43 0.09
44 0.1
45 0.11
46 0.1
47 0.1
48 0.11
49 0.16
50 0.19
51 0.27
52 0.35
53 0.44
54 0.51
55 0.61
56 0.68
57 0.72
58 0.75
59 0.76
60 0.78
61 0.78
62 0.84
63 0.84
64 0.87
65 0.86
66 0.88
67 0.88
68 0.87
69 0.86
70 0.84
71 0.83
72 0.82
73 0.8
74 0.81