Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7RX45

Protein Details
Accession A0A1X7RX45    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
285-311IALLTICLRRRRNRRKQPPLPGPPSYPHydrophilic
NLS Segment(s)
PositionSequence
294-301RRRNRRKQ
Subcellular Location(s) extr 25
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFKRLATAACFALVATAVLGQQQCYYGPGAQYRGGSNLVPCNTTGTSACCLQGDTCLSGNSCYNVLTGNVYMYGCTDIMYKDSTCPYKCGFDPLKSPWTALEYCNDVQDFSNAWVCHAPESCGCEWNPTPDMLVLTPRGCKDMGSDALVALYAPKQLAPYVSLPSKAGGSTGYYSPTIGTDGTSSWVETAVPGYTPTPFTQLTTYRKAPTTSVFVDASATPGPSTYAAAASYSAPPSRSGPTSTTSTSSAPLATSSSNSSSDLSTGAKAGIGGGIAGGVLFLAAIALLTICLRRRRNRRKQPPLPGPPSYPHSPYSTQSPMQGISPWPQYPAGVISEQYFSHAGHLPQYRQTPPSVEDTAYKHQPVQGIAGRPLSPLELAADAPLRHEMAVAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.07
3 0.07
4 0.06
5 0.09
6 0.1
7 0.1
8 0.11
9 0.11
10 0.11
11 0.12
12 0.15
13 0.14
14 0.18
15 0.21
16 0.24
17 0.26
18 0.28
19 0.27
20 0.28
21 0.27
22 0.24
23 0.23
24 0.27
25 0.26
26 0.25
27 0.23
28 0.25
29 0.24
30 0.25
31 0.23
32 0.19
33 0.2
34 0.21
35 0.22
36 0.18
37 0.18
38 0.16
39 0.2
40 0.19
41 0.18
42 0.18
43 0.19
44 0.19
45 0.19
46 0.21
47 0.18
48 0.15
49 0.13
50 0.12
51 0.12
52 0.12
53 0.12
54 0.11
55 0.1
56 0.11
57 0.11
58 0.1
59 0.1
60 0.11
61 0.09
62 0.09
63 0.09
64 0.08
65 0.1
66 0.13
67 0.12
68 0.14
69 0.19
70 0.25
71 0.25
72 0.28
73 0.29
74 0.31
75 0.31
76 0.38
77 0.37
78 0.36
79 0.4
80 0.43
81 0.47
82 0.43
83 0.43
84 0.34
85 0.34
86 0.32
87 0.27
88 0.24
89 0.22
90 0.22
91 0.24
92 0.23
93 0.19
94 0.18
95 0.18
96 0.16
97 0.13
98 0.18
99 0.15
100 0.16
101 0.17
102 0.17
103 0.19
104 0.18
105 0.18
106 0.15
107 0.2
108 0.2
109 0.21
110 0.21
111 0.23
112 0.23
113 0.26
114 0.25
115 0.2
116 0.2
117 0.18
118 0.19
119 0.14
120 0.16
121 0.13
122 0.13
123 0.15
124 0.15
125 0.16
126 0.15
127 0.14
128 0.14
129 0.18
130 0.18
131 0.18
132 0.18
133 0.16
134 0.16
135 0.16
136 0.13
137 0.08
138 0.06
139 0.05
140 0.05
141 0.05
142 0.05
143 0.06
144 0.07
145 0.09
146 0.1
147 0.13
148 0.14
149 0.15
150 0.15
151 0.15
152 0.15
153 0.12
154 0.11
155 0.08
156 0.08
157 0.09
158 0.09
159 0.11
160 0.1
161 0.1
162 0.1
163 0.1
164 0.09
165 0.07
166 0.07
167 0.06
168 0.06
169 0.08
170 0.08
171 0.07
172 0.07
173 0.07
174 0.06
175 0.06
176 0.06
177 0.04
178 0.04
179 0.05
180 0.05
181 0.06
182 0.08
183 0.08
184 0.1
185 0.1
186 0.11
187 0.14
188 0.19
189 0.23
190 0.28
191 0.3
192 0.29
193 0.3
194 0.31
195 0.29
196 0.25
197 0.26
198 0.21
199 0.22
200 0.2
201 0.18
202 0.18
203 0.17
204 0.17
205 0.12
206 0.1
207 0.07
208 0.07
209 0.08
210 0.07
211 0.07
212 0.06
213 0.06
214 0.06
215 0.06
216 0.07
217 0.07
218 0.08
219 0.09
220 0.1
221 0.1
222 0.11
223 0.13
224 0.15
225 0.15
226 0.17
227 0.17
228 0.2
229 0.23
230 0.23
231 0.23
232 0.22
233 0.21
234 0.2
235 0.18
236 0.16
237 0.12
238 0.11
239 0.1
240 0.09
241 0.09
242 0.1
243 0.12
244 0.12
245 0.13
246 0.14
247 0.13
248 0.13
249 0.13
250 0.12
251 0.1
252 0.09
253 0.08
254 0.08
255 0.07
256 0.07
257 0.06
258 0.05
259 0.04
260 0.03
261 0.03
262 0.03
263 0.03
264 0.02
265 0.02
266 0.02
267 0.01
268 0.01
269 0.01
270 0.01
271 0.01
272 0.02
273 0.02
274 0.02
275 0.03
276 0.05
277 0.09
278 0.17
279 0.24
280 0.33
281 0.45
282 0.57
283 0.68
284 0.78
285 0.85
286 0.89
287 0.93
288 0.95
289 0.95
290 0.94
291 0.9
292 0.83
293 0.76
294 0.69
295 0.65
296 0.58
297 0.5
298 0.41
299 0.39
300 0.38
301 0.35
302 0.38
303 0.38
304 0.35
305 0.34
306 0.34
307 0.3
308 0.28
309 0.28
310 0.23
311 0.22
312 0.27
313 0.24
314 0.24
315 0.24
316 0.23
317 0.22
318 0.22
319 0.19
320 0.15
321 0.15
322 0.15
323 0.16
324 0.16
325 0.18
326 0.16
327 0.14
328 0.16
329 0.19
330 0.18
331 0.23
332 0.29
333 0.29
334 0.34
335 0.39
336 0.4
337 0.38
338 0.4
339 0.37
340 0.34
341 0.38
342 0.35
343 0.31
344 0.32
345 0.36
346 0.41
347 0.42
348 0.41
349 0.36
350 0.36
351 0.38
352 0.35
353 0.36
354 0.34
355 0.34
356 0.35
357 0.38
358 0.35
359 0.33
360 0.32
361 0.26
362 0.2
363 0.16
364 0.15
365 0.12
366 0.12
367 0.13
368 0.16
369 0.15
370 0.16
371 0.18
372 0.16
373 0.15