Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZPD2

Protein Details
Accession G8ZPD2   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
177-206RTLNRAQRKELVKKNQRQQKKNMRNSGVSKHydrophilic
NLS Segment(s)
PositionSequence
102-130EKPLPKPKAPTKWELFAAKKGIKPKERAG
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG tdl:TDEL_0B03470  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSTKDYKSLPVTVEKPIPVTYDLGNLAVFDSNVVDRNDVDSSNGKREQNIRSLTRDNVQLLINQILSLPIKTTTESAGGTGNQSASMTLIQLPGPTTELPREKPLPKPKAPTKWELFAAKKGIKPKERAGKMVYDEEAGEWVPKWGYKGANKKLDDQWLVEIDDKVKNTEDELVDPRTLNRAQRKELVKKNQRQQKKNMRNSGVSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.33
4 0.32
5 0.26
6 0.26
7 0.21
8 0.2
9 0.2
10 0.18
11 0.17
12 0.14
13 0.13
14 0.12
15 0.11
16 0.07
17 0.08
18 0.08
19 0.12
20 0.12
21 0.12
22 0.12
23 0.15
24 0.16
25 0.15
26 0.16
27 0.19
28 0.22
29 0.28
30 0.33
31 0.31
32 0.33
33 0.39
34 0.41
35 0.43
36 0.46
37 0.43
38 0.43
39 0.46
40 0.45
41 0.43
42 0.41
43 0.34
44 0.3
45 0.27
46 0.22
47 0.21
48 0.2
49 0.16
50 0.13
51 0.12
52 0.11
53 0.11
54 0.09
55 0.08
56 0.07
57 0.08
58 0.09
59 0.1
60 0.09
61 0.1
62 0.1
63 0.1
64 0.11
65 0.1
66 0.1
67 0.1
68 0.09
69 0.07
70 0.07
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.07
80 0.06
81 0.08
82 0.08
83 0.08
84 0.11
85 0.14
86 0.15
87 0.19
88 0.23
89 0.24
90 0.32
91 0.41
92 0.45
93 0.47
94 0.54
95 0.57
96 0.63
97 0.64
98 0.63
99 0.57
100 0.52
101 0.52
102 0.49
103 0.43
104 0.37
105 0.39
106 0.34
107 0.33
108 0.37
109 0.41
110 0.41
111 0.43
112 0.48
113 0.52
114 0.52
115 0.53
116 0.48
117 0.46
118 0.44
119 0.42
120 0.34
121 0.25
122 0.22
123 0.19
124 0.17
125 0.12
126 0.1
127 0.07
128 0.07
129 0.06
130 0.07
131 0.08
132 0.11
133 0.16
134 0.23
135 0.34
136 0.42
137 0.5
138 0.51
139 0.55
140 0.57
141 0.59
142 0.53
143 0.45
144 0.39
145 0.33
146 0.33
147 0.29
148 0.25
149 0.2
150 0.22
151 0.2
152 0.19
153 0.18
154 0.17
155 0.16
156 0.21
157 0.19
158 0.2
159 0.23
160 0.25
161 0.24
162 0.24
163 0.24
164 0.24
165 0.26
166 0.3
167 0.36
168 0.4
169 0.44
170 0.52
171 0.6
172 0.65
173 0.72
174 0.75
175 0.76
176 0.79
177 0.84
178 0.86
179 0.88
180 0.86
181 0.87
182 0.87
183 0.88
184 0.89
185 0.89
186 0.86