Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZYY0

Protein Details
Accession G8ZYY0   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
37-58KVTSTSKKEKGKKPFKFELKKDBasic
NLS Segment(s)
PositionSequence
41-52TSKKEKGKKPFK
Subcellular Location(s) E.R. 9, cyto 7.5, cyto_nucl 5.5, extr 4, vacu 3, nucl 2.5
Family & Domain DBs
KEGG tdl:TDEL_0G02380  -  
Amino Acid Sequences MDLYAFLVVFALVLLFVVLLPTVSGIGSFSVNKSGRKVTSTSKKEKGKKPFKFELKKDADVERTETGLSTAHKTGKLEIDPRTGLKRRVIGKYDENPNNYDYDLDELVNEDRIEEEKAQAQRLKQFQGSTEKAYEELV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.03
11 0.04
12 0.04
13 0.05
14 0.07
15 0.07
16 0.08
17 0.15
18 0.18
19 0.19
20 0.22
21 0.26
22 0.26
23 0.28
24 0.3
25 0.32
26 0.41
27 0.48
28 0.53
29 0.57
30 0.65
31 0.71
32 0.77
33 0.79
34 0.79
35 0.79
36 0.8
37 0.8
38 0.82
39 0.82
40 0.78
41 0.77
42 0.73
43 0.68
44 0.62
45 0.55
46 0.47
47 0.39
48 0.39
49 0.28
50 0.22
51 0.18
52 0.16
53 0.13
54 0.11
55 0.11
56 0.1
57 0.11
58 0.12
59 0.13
60 0.13
61 0.15
62 0.16
63 0.18
64 0.2
65 0.2
66 0.22
67 0.22
68 0.24
69 0.29
70 0.29
71 0.3
72 0.29
73 0.33
74 0.35
75 0.4
76 0.41
77 0.4
78 0.44
79 0.48
80 0.54
81 0.53
82 0.5
83 0.46
84 0.44
85 0.4
86 0.32
87 0.25
88 0.16
89 0.15
90 0.13
91 0.12
92 0.11
93 0.11
94 0.11
95 0.13
96 0.12
97 0.09
98 0.09
99 0.11
100 0.13
101 0.13
102 0.14
103 0.18
104 0.21
105 0.26
106 0.28
107 0.3
108 0.36
109 0.4
110 0.43
111 0.41
112 0.4
113 0.4
114 0.47
115 0.48
116 0.45
117 0.42
118 0.38