Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7S5J2

Protein Details
Accession A0A1X7S5J2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
31-59QRLPRSRNLRPSRRAPRVRRRSRYLCCTGHydrophilic
NLS Segment(s)
PositionSequence
23-52PNLPPRPPQRLPRSRNLRPSRRAPRVRRRS
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MGEVSLNKASPLHPPPLLHPLKPNLPPRPPQRLPRSRNLRPSRRAPRVRRRSRYLCCTGSDGRDRVGSRGYRVLYCDERLYAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.41
4 0.43
5 0.36
6 0.38
7 0.38
8 0.41
9 0.48
10 0.52
11 0.49
12 0.52
13 0.58
14 0.6
15 0.65
16 0.64
17 0.66
18 0.69
19 0.71
20 0.71
21 0.74
22 0.76
23 0.72
24 0.78
25 0.78
26 0.76
27 0.72
28 0.77
29 0.76
30 0.77
31 0.8
32 0.8
33 0.81
34 0.84
35 0.88
36 0.86
37 0.86
38 0.85
39 0.83
40 0.82
41 0.78
42 0.7
43 0.61
44 0.58
45 0.52
46 0.48
47 0.46
48 0.39
49 0.33
50 0.35
51 0.33
52 0.3
53 0.34
54 0.3
55 0.28
56 0.33
57 0.34
58 0.3
59 0.31
60 0.36
61 0.34
62 0.35
63 0.34