Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8ZW67

Protein Details
Accession G8ZW67    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-115AIKARNERIKQTKQQARNRYGWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 5.5, pero 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018800  PRCC  
KEGG tdl:TDEL_0F00500  -  
Pfam View protein in Pfam  
PF10253  PRCC  
Amino Acid Sequences MTSDAQGVFADGHDRLQWDIQESNFRAVKVDPKEMAVTAPKATSVAQAQAVEPVLSTANAPNETFEPATPLADVHDRRNQLTSLVQNARRNEEAIKARNERIKQTKQQARNRYGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.15
5 0.16
6 0.18
7 0.19
8 0.26
9 0.26
10 0.31
11 0.3
12 0.3
13 0.27
14 0.26
15 0.33
16 0.29
17 0.32
18 0.27
19 0.27
20 0.28
21 0.27
22 0.27
23 0.22
24 0.19
25 0.15
26 0.14
27 0.12
28 0.12
29 0.12
30 0.12
31 0.1
32 0.1
33 0.11
34 0.11
35 0.11
36 0.12
37 0.12
38 0.09
39 0.08
40 0.07
41 0.05
42 0.05
43 0.05
44 0.05
45 0.07
46 0.08
47 0.08
48 0.08
49 0.08
50 0.1
51 0.1
52 0.09
53 0.11
54 0.1
55 0.11
56 0.1
57 0.09
58 0.09
59 0.14
60 0.16
61 0.17
62 0.23
63 0.24
64 0.25
65 0.27
66 0.26
67 0.22
68 0.25
69 0.23
70 0.26
71 0.31
72 0.36
73 0.39
74 0.41
75 0.45
76 0.42
77 0.41
78 0.34
79 0.35
80 0.37
81 0.38
82 0.43
83 0.43
84 0.47
85 0.53
86 0.54
87 0.56
88 0.58
89 0.62
90 0.64
91 0.7
92 0.75
93 0.78
94 0.85
95 0.86