Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7RQ49

Protein Details
Accession A0A1X7RQ49    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-79AYFWIKKCKHCYDRTCNPKAPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 24, mito 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MKPIVWFLAFLPAALACGGQNVCQCQDISNTQVCQCPPTTDNDCTSACDNWHKYVDCNAYFWIKKCKHCYDRTCNPKAPTTTLNNCPSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.05
4 0.08
5 0.08
6 0.1
7 0.12
8 0.13
9 0.14
10 0.15
11 0.15
12 0.14
13 0.17
14 0.17
15 0.19
16 0.2
17 0.2
18 0.2
19 0.23
20 0.22
21 0.21
22 0.19
23 0.19
24 0.16
25 0.21
26 0.25
27 0.24
28 0.25
29 0.27
30 0.26
31 0.25
32 0.26
33 0.2
34 0.17
35 0.2
36 0.21
37 0.2
38 0.23
39 0.22
40 0.22
41 0.28
42 0.33
43 0.27
44 0.27
45 0.26
46 0.28
47 0.29
48 0.31
49 0.34
50 0.34
51 0.4
52 0.47
53 0.56
54 0.59
55 0.67
56 0.75
57 0.74
58 0.8
59 0.83
60 0.83
61 0.8
62 0.74
63 0.73
64 0.66
65 0.62
66 0.58
67 0.57
68 0.57
69 0.58