Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7REZ9

Protein Details
Accession A0A1X7REZ9   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
253-280AEKCPSCEKIEKKLRRRDKAMSDWKRWSHydrophilic
NLS Segment(s)
PositionSequence
267-269RRR
Subcellular Location(s) nucl 15, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MEDRVHAEPRIVQTTLSGSFRDRPYPVCHVRGALVWARDLSSVGNVTDSITLFPPIAQPLYHYRQRDPPSSQPDQALLNVPDMRKDRKGFATRSHKLQQVASSADSAVRTDGSSFLLPPFIIARILSSHPFPHIHHNVLPWSIDPLPQPCIFPALSRSEAIGKSQTSVHNPVVAPIRLIPPTFSFPKRQSTQNKHFVFQNSNGTHPKKMCYYDNFKFACQDWKWGNFRQHCQKEYRTGETCGMKMIYNTMLLAEKCPSCEKIEKKLRRRDKAMSDWKRWSQQGGKFKASMEKAVEDVKTLEREIEALQREKERRYAAVGNARRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.27
4 0.23
5 0.21
6 0.28
7 0.31
8 0.35
9 0.32
10 0.33
11 0.37
12 0.46
13 0.5
14 0.47
15 0.46
16 0.42
17 0.41
18 0.39
19 0.37
20 0.33
21 0.27
22 0.24
23 0.23
24 0.22
25 0.21
26 0.19
27 0.15
28 0.13
29 0.13
30 0.12
31 0.12
32 0.11
33 0.12
34 0.13
35 0.12
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.12
42 0.12
43 0.13
44 0.11
45 0.13
46 0.2
47 0.27
48 0.33
49 0.34
50 0.35
51 0.44
52 0.49
53 0.53
54 0.52
55 0.55
56 0.57
57 0.6
58 0.59
59 0.51
60 0.48
61 0.42
62 0.37
63 0.33
64 0.25
65 0.23
66 0.24
67 0.22
68 0.26
69 0.28
70 0.31
71 0.32
72 0.33
73 0.34
74 0.41
75 0.48
76 0.47
77 0.54
78 0.6
79 0.58
80 0.63
81 0.63
82 0.58
83 0.53
84 0.51
85 0.45
86 0.38
87 0.36
88 0.29
89 0.24
90 0.2
91 0.19
92 0.17
93 0.13
94 0.1
95 0.08
96 0.07
97 0.07
98 0.08
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.09
105 0.09
106 0.09
107 0.07
108 0.07
109 0.07
110 0.07
111 0.09
112 0.1
113 0.11
114 0.11
115 0.12
116 0.13
117 0.16
118 0.16
119 0.23
120 0.25
121 0.27
122 0.27
123 0.28
124 0.27
125 0.26
126 0.25
127 0.16
128 0.15
129 0.13
130 0.13
131 0.12
132 0.13
133 0.15
134 0.16
135 0.16
136 0.13
137 0.15
138 0.13
139 0.13
140 0.14
141 0.15
142 0.15
143 0.15
144 0.16
145 0.16
146 0.16
147 0.17
148 0.16
149 0.12
150 0.12
151 0.14
152 0.15
153 0.16
154 0.2
155 0.19
156 0.2
157 0.2
158 0.21
159 0.23
160 0.21
161 0.18
162 0.15
163 0.17
164 0.15
165 0.15
166 0.14
167 0.12
168 0.16
169 0.19
170 0.2
171 0.23
172 0.25
173 0.33
174 0.35
175 0.41
176 0.48
177 0.54
178 0.61
179 0.66
180 0.65
181 0.59
182 0.6
183 0.56
184 0.5
185 0.44
186 0.44
187 0.35
188 0.37
189 0.41
190 0.4
191 0.4
192 0.36
193 0.35
194 0.3
195 0.32
196 0.34
197 0.35
198 0.41
199 0.42
200 0.49
201 0.48
202 0.44
203 0.43
204 0.39
205 0.4
206 0.32
207 0.35
208 0.3
209 0.36
210 0.4
211 0.44
212 0.51
213 0.49
214 0.56
215 0.6
216 0.64
217 0.61
218 0.63
219 0.61
220 0.63
221 0.62
222 0.61
223 0.54
224 0.49
225 0.51
226 0.47
227 0.43
228 0.35
229 0.31
230 0.24
231 0.2
232 0.19
233 0.15
234 0.12
235 0.12
236 0.11
237 0.13
238 0.13
239 0.14
240 0.15
241 0.15
242 0.17
243 0.19
244 0.2
245 0.22
246 0.3
247 0.34
248 0.41
249 0.52
250 0.6
251 0.67
252 0.76
253 0.82
254 0.83
255 0.85
256 0.84
257 0.82
258 0.83
259 0.85
260 0.83
261 0.8
262 0.79
263 0.79
264 0.76
265 0.68
266 0.64
267 0.61
268 0.61
269 0.63
270 0.61
271 0.59
272 0.54
273 0.54
274 0.55
275 0.49
276 0.45
277 0.39
278 0.33
279 0.31
280 0.33
281 0.32
282 0.25
283 0.25
284 0.24
285 0.23
286 0.21
287 0.2
288 0.17
289 0.18
290 0.18
291 0.23
292 0.25
293 0.26
294 0.3
295 0.38
296 0.42
297 0.44
298 0.48
299 0.45
300 0.42
301 0.45
302 0.47
303 0.47
304 0.53