Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7S3J6

Protein Details
Accession A0A1X7S3J6   
Localization Confidence High
Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MWTSRMRKSCRSASRRKAEDISHydrophilic
60-91DNNNATRKLKRLRRRSKKKKDWRLKAMAKPNPBasic
NLS Segment(s)
PositionSequence
16-17RK
23-86NGGGEKKNGDGEKKNRGGEKNDRPRKAITDPKRKRAEDNNNATRKLKRLRRRSKKKKDWRLKAM
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MWTSRMRKSCRSASRRKAEDISNGGGEKKNGDGEKKNRGGEKNDRPRKAITDPKRKRAEDNNNATRKLKRLRRRSKKKKDWRLKAMAKPNPDADSGTLETVRLYKRAQRRANENTPLVPTPAGKARGITAIDEVTEGFTGRFVSTATLPVQEMFPVDDRSASLSFSIDEIMQELTHQDATKAYGNDGVHIRLMKTLATTSFLQILAALYNSCLRNSKTPRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.81
4 0.76
5 0.7
6 0.69
7 0.63
8 0.56
9 0.49
10 0.44
11 0.4
12 0.36
13 0.32
14 0.25
15 0.21
16 0.23
17 0.22
18 0.27
19 0.34
20 0.39
21 0.49
22 0.54
23 0.56
24 0.56
25 0.58
26 0.6
27 0.62
28 0.66
29 0.67
30 0.71
31 0.69
32 0.66
33 0.65
34 0.63
35 0.61
36 0.6
37 0.6
38 0.61
39 0.67
40 0.74
41 0.8
42 0.75
43 0.74
44 0.74
45 0.75
46 0.73
47 0.76
48 0.76
49 0.71
50 0.72
51 0.67
52 0.59
53 0.55
54 0.54
55 0.53
56 0.53
57 0.6
58 0.69
59 0.78
60 0.87
61 0.91
62 0.93
63 0.95
64 0.96
65 0.96
66 0.96
67 0.95
68 0.93
69 0.93
70 0.9
71 0.87
72 0.86
73 0.79
74 0.72
75 0.63
76 0.56
77 0.47
78 0.39
79 0.31
80 0.22
81 0.21
82 0.18
83 0.16
84 0.13
85 0.11
86 0.11
87 0.13
88 0.12
89 0.1
90 0.1
91 0.16
92 0.24
93 0.34
94 0.39
95 0.41
96 0.49
97 0.56
98 0.62
99 0.61
100 0.54
101 0.46
102 0.42
103 0.39
104 0.31
105 0.23
106 0.16
107 0.12
108 0.16
109 0.16
110 0.14
111 0.14
112 0.14
113 0.17
114 0.17
115 0.16
116 0.12
117 0.1
118 0.1
119 0.1
120 0.09
121 0.06
122 0.06
123 0.06
124 0.04
125 0.05
126 0.05
127 0.05
128 0.06
129 0.05
130 0.07
131 0.07
132 0.09
133 0.1
134 0.1
135 0.1
136 0.11
137 0.11
138 0.09
139 0.09
140 0.08
141 0.1
142 0.11
143 0.11
144 0.1
145 0.11
146 0.14
147 0.14
148 0.13
149 0.11
150 0.1
151 0.1
152 0.1
153 0.1
154 0.07
155 0.06
156 0.07
157 0.07
158 0.07
159 0.06
160 0.07
161 0.07
162 0.09
163 0.09
164 0.08
165 0.09
166 0.12
167 0.18
168 0.18
169 0.17
170 0.2
171 0.2
172 0.24
173 0.25
174 0.23
175 0.2
176 0.2
177 0.2
178 0.17
179 0.18
180 0.14
181 0.14
182 0.15
183 0.13
184 0.16
185 0.17
186 0.17
187 0.19
188 0.18
189 0.17
190 0.15
191 0.15
192 0.12
193 0.11
194 0.1
195 0.08
196 0.14
197 0.15
198 0.16
199 0.2
200 0.22
201 0.32