Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7RIL1

Protein Details
Accession A0A1X7RIL1   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
321-344HDGGATRGKKRRRERDEDDSEEDRBasic
NLS Segment(s)
PositionSequence
324-334GATRGKKRRRE
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022190  DUF3716  
Pfam View protein in Pfam  
PF12511  DUF3716  
Amino Acid Sequences MFDSSDPDVTQDERTTDPPQASTSTALPTPEPAAARARGTEGEEEANLKAPKDKDGKDLDLSKAWTVKEALSHPQVYDLAQLTYIYFNLDKVGKGAPTALKGFVKENDCMMPMFDLKYKIQSDIKSAVNAGTGAPLSAMFGQASADRTAHTDKCGECAKEKGKFSECVTAVVNKAGDPYLKGACMNCMMGGSATDCSLSDAFGIPQRDSSKAGKKDKTASSTAATASTPAPATPIVSAMALHSLTRTGRHLRIPLTANSNYETADGLLSLMGDIAAYHSGLLATVRSLNATGIEALGEQKDFRIRADVNAQAMGGKKSVGHDGGATRGKKRRRERDEDDSEEDRKPSMAEMTEGFRRMEKKITKLQEDMAAMRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.3
4 0.3
5 0.28
6 0.28
7 0.28
8 0.27
9 0.26
10 0.25
11 0.23
12 0.23
13 0.23
14 0.21
15 0.2
16 0.21
17 0.21
18 0.2
19 0.19
20 0.22
21 0.24
22 0.25
23 0.24
24 0.24
25 0.23
26 0.24
27 0.24
28 0.21
29 0.2
30 0.19
31 0.2
32 0.18
33 0.23
34 0.21
35 0.19
36 0.23
37 0.22
38 0.3
39 0.36
40 0.38
41 0.39
42 0.45
43 0.49
44 0.5
45 0.53
46 0.48
47 0.45
48 0.44
49 0.39
50 0.36
51 0.31
52 0.27
53 0.24
54 0.22
55 0.22
56 0.23
57 0.27
58 0.28
59 0.3
60 0.27
61 0.28
62 0.28
63 0.24
64 0.24
65 0.19
66 0.14
67 0.13
68 0.14
69 0.12
70 0.12
71 0.11
72 0.1
73 0.08
74 0.08
75 0.11
76 0.12
77 0.11
78 0.12
79 0.14
80 0.12
81 0.12
82 0.16
83 0.15
84 0.17
85 0.18
86 0.2
87 0.19
88 0.2
89 0.22
90 0.24
91 0.25
92 0.23
93 0.23
94 0.21
95 0.21
96 0.2
97 0.18
98 0.14
99 0.12
100 0.13
101 0.14
102 0.15
103 0.15
104 0.21
105 0.21
106 0.23
107 0.27
108 0.26
109 0.28
110 0.3
111 0.31
112 0.26
113 0.25
114 0.22
115 0.18
116 0.17
117 0.12
118 0.09
119 0.07
120 0.06
121 0.06
122 0.05
123 0.05
124 0.05
125 0.06
126 0.04
127 0.05
128 0.05
129 0.06
130 0.08
131 0.08
132 0.08
133 0.08
134 0.11
135 0.14
136 0.15
137 0.15
138 0.17
139 0.16
140 0.2
141 0.24
142 0.23
143 0.21
144 0.27
145 0.3
146 0.33
147 0.35
148 0.35
149 0.34
150 0.36
151 0.37
152 0.38
153 0.34
154 0.29
155 0.29
156 0.26
157 0.23
158 0.21
159 0.19
160 0.11
161 0.11
162 0.09
163 0.08
164 0.07
165 0.09
166 0.09
167 0.09
168 0.09
169 0.09
170 0.09
171 0.1
172 0.1
173 0.07
174 0.07
175 0.06
176 0.06
177 0.06
178 0.06
179 0.05
180 0.05
181 0.05
182 0.05
183 0.06
184 0.06
185 0.06
186 0.05
187 0.05
188 0.06
189 0.09
190 0.11
191 0.09
192 0.13
193 0.14
194 0.15
195 0.18
196 0.23
197 0.28
198 0.36
199 0.44
200 0.44
201 0.47
202 0.53
203 0.54
204 0.54
205 0.47
206 0.41
207 0.35
208 0.33
209 0.3
210 0.23
211 0.18
212 0.15
213 0.12
214 0.11
215 0.09
216 0.08
217 0.08
218 0.07
219 0.08
220 0.07
221 0.08
222 0.07
223 0.07
224 0.07
225 0.06
226 0.08
227 0.07
228 0.07
229 0.06
230 0.07
231 0.08
232 0.09
233 0.13
234 0.16
235 0.19
236 0.23
237 0.27
238 0.27
239 0.32
240 0.34
241 0.34
242 0.36
243 0.34
244 0.32
245 0.3
246 0.28
247 0.23
248 0.2
249 0.17
250 0.11
251 0.09
252 0.08
253 0.06
254 0.05
255 0.05
256 0.04
257 0.04
258 0.03
259 0.03
260 0.03
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.05
269 0.04
270 0.05
271 0.06
272 0.06
273 0.07
274 0.07
275 0.08
276 0.08
277 0.09
278 0.08
279 0.07
280 0.07
281 0.07
282 0.07
283 0.08
284 0.08
285 0.07
286 0.08
287 0.13
288 0.13
289 0.13
290 0.19
291 0.19
292 0.23
293 0.29
294 0.31
295 0.28
296 0.28
297 0.27
298 0.23
299 0.24
300 0.21
301 0.16
302 0.12
303 0.12
304 0.13
305 0.17
306 0.16
307 0.15
308 0.17
309 0.18
310 0.25
311 0.31
312 0.31
313 0.34
314 0.4
315 0.48
316 0.55
317 0.64
318 0.68
319 0.71
320 0.8
321 0.82
322 0.85
323 0.87
324 0.84
325 0.8
326 0.74
327 0.67
328 0.6
329 0.52
330 0.41
331 0.32
332 0.25
333 0.2
334 0.19
335 0.17
336 0.17
337 0.19
338 0.23
339 0.27
340 0.29
341 0.28
342 0.27
343 0.29
344 0.29
345 0.37
346 0.38
347 0.42
348 0.5
349 0.58
350 0.6
351 0.61
352 0.62
353 0.59
354 0.56