Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7SA87

Protein Details
Accession A0A1X7SA87    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-42KTDVLPGRSRRHQSRRSRQRRRRRTRQLGYALRRABasic
NLS Segment(s)
PositionSequence
15-33RSRRHQSRRSRQRRRRRTR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MEQTSMSKTDVLPGRSRRHQSRRSRQRRRRRTRQLGYALRRAFVFLLQTLHRCFNRDIWFGVFRTRRDLSPPLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.53
3 0.61
4 0.64
5 0.68
6 0.75
7 0.78
8 0.82
9 0.86
10 0.89
11 0.93
12 0.93
13 0.94
14 0.96
15 0.95
16 0.95
17 0.95
18 0.95
19 0.92
20 0.91
21 0.9
22 0.88
23 0.82
24 0.78
25 0.67
26 0.56
27 0.47
28 0.38
29 0.28
30 0.19
31 0.16
32 0.09
33 0.11
34 0.11
35 0.14
36 0.16
37 0.2
38 0.2
39 0.22
40 0.23
41 0.27
42 0.33
43 0.33
44 0.33
45 0.33
46 0.36
47 0.34
48 0.41
49 0.39
50 0.33
51 0.38
52 0.38
53 0.34
54 0.37
55 0.43