Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7RXF6

Protein Details
Accession A0A1X7RXF6    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
143-169EKETPAKKAKAPRKKKTPVKVKAEADEBasic
NLS Segment(s)
PositionSequence
147-163PAKKAKAPRKKKTPVKV
Subcellular Location(s) cyto 17, cyto_nucl 12.666, cyto_mito 10.166, nucl 7, mito_nucl 5.166
Family & Domain DBs
Amino Acid Sequences MSDTAAPKKSATGWTEAEKLGILFQVIEKAGAIPWSELTLPEGRTQKACQVMVDKEKKKVRDAKAAAGEATPSGATPASTTTPAGKGKVRPSPSSLSSRATALETGGFSLTAAISQLADQVILTEQKRSAKAAGEGGDEDDEEKETPAKKAKAPRKKKTPVKVKAEADEGEEETKVEEGDEGGAKVKGEEDDDMVGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.36
4 0.32
5 0.26
6 0.23
7 0.18
8 0.15
9 0.1
10 0.07
11 0.08
12 0.1
13 0.1
14 0.1
15 0.09
16 0.09
17 0.1
18 0.11
19 0.11
20 0.08
21 0.09
22 0.1
23 0.1
24 0.1
25 0.12
26 0.14
27 0.15
28 0.2
29 0.23
30 0.23
31 0.25
32 0.27
33 0.29
34 0.31
35 0.31
36 0.27
37 0.29
38 0.32
39 0.4
40 0.48
41 0.46
42 0.48
43 0.53
44 0.54
45 0.57
46 0.61
47 0.57
48 0.58
49 0.58
50 0.58
51 0.58
52 0.57
53 0.49
54 0.4
55 0.34
56 0.23
57 0.2
58 0.12
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.07
66 0.08
67 0.09
68 0.09
69 0.13
70 0.14
71 0.16
72 0.17
73 0.2
74 0.25
75 0.31
76 0.34
77 0.32
78 0.35
79 0.37
80 0.37
81 0.39
82 0.35
83 0.31
84 0.28
85 0.26
86 0.23
87 0.19
88 0.16
89 0.11
90 0.09
91 0.07
92 0.07
93 0.06
94 0.05
95 0.05
96 0.05
97 0.04
98 0.03
99 0.04
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.08
110 0.08
111 0.09
112 0.11
113 0.15
114 0.16
115 0.17
116 0.18
117 0.17
118 0.19
119 0.21
120 0.21
121 0.19
122 0.18
123 0.18
124 0.17
125 0.14
126 0.13
127 0.09
128 0.09
129 0.08
130 0.08
131 0.1
132 0.11
133 0.14
134 0.21
135 0.24
136 0.28
137 0.38
138 0.48
139 0.56
140 0.66
141 0.73
142 0.77
143 0.85
144 0.9
145 0.9
146 0.91
147 0.9
148 0.88
149 0.87
150 0.81
151 0.75
152 0.7
153 0.6
154 0.52
155 0.44
156 0.37
157 0.28
158 0.23
159 0.19
160 0.15
161 0.14
162 0.11
163 0.08
164 0.07
165 0.06
166 0.08
167 0.1
168 0.1
169 0.11
170 0.12
171 0.12
172 0.12
173 0.13
174 0.12
175 0.13
176 0.14
177 0.14