Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7RQD7

Protein Details
Accession A0A1X7RQD7    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-36IPDKSEQTREKERKHIEQYKQLESHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9, nucl 8.5, cyto 8.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002088  Prenyl_trans_a  
Gene Ontology GO:0005968  C:Rab-protein geranylgeranyltransferase complex  
GO:0004663  F:Rab geranylgeranyltransferase activity  
GO:0018344  P:protein geranylgeranylation  
Pfam View protein in Pfam  
PF01239  PPTA  
PROSITE View protein in PROSITE  
PS51147  PFTA  
Amino Acid Sequences MASHGVPRVAGGIPDKSEQTREKERKHIEQYKQLESEVTEKIRAKDYSNTTLQLTSKLLSANPEYYTIWNYRRLILEDVFAKELETKADSVEEGDAAAAQEAGLTTAQREIALLVKEDLQFLVPLLKQYPKCYWIWNHRSWLLATATKHVPPHGTLPLWQAELGLVSKMLSLDSRNFHGWGYRRDVVKNLEDLSGKSMVEPEYEYTTKMIQSNLSNFSAWHNRGQLIPRLLNERQADSAQRKELFDAEFELVTRALYTDPYDQSLWFYHQYLMSALDSKNPHAPEILSPCTNSDRLHYLEQEIDSIREMLDGAEDCKYIYQALLEYAPRYFVVEAGNKAITPAEMTDWLDELKKIDPLRAGRWEDLGRALKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.25
4 0.31
5 0.34
6 0.38
7 0.45
8 0.52
9 0.57
10 0.65
11 0.71
12 0.75
13 0.8
14 0.83
15 0.8
16 0.81
17 0.8
18 0.78
19 0.72
20 0.62
21 0.53
22 0.45
23 0.4
24 0.36
25 0.32
26 0.29
27 0.31
28 0.33
29 0.38
30 0.38
31 0.37
32 0.4
33 0.44
34 0.46
35 0.46
36 0.45
37 0.4
38 0.42
39 0.39
40 0.33
41 0.28
42 0.22
43 0.2
44 0.19
45 0.18
46 0.18
47 0.21
48 0.2
49 0.2
50 0.22
51 0.21
52 0.22
53 0.25
54 0.26
55 0.26
56 0.3
57 0.3
58 0.31
59 0.33
60 0.35
61 0.35
62 0.31
63 0.32
64 0.28
65 0.29
66 0.27
67 0.23
68 0.21
69 0.18
70 0.17
71 0.15
72 0.13
73 0.11
74 0.11
75 0.11
76 0.11
77 0.1
78 0.1
79 0.08
80 0.07
81 0.07
82 0.06
83 0.06
84 0.06
85 0.04
86 0.03
87 0.04
88 0.03
89 0.04
90 0.04
91 0.04
92 0.05
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.1
99 0.11
100 0.11
101 0.11
102 0.13
103 0.14
104 0.14
105 0.13
106 0.1
107 0.09
108 0.09
109 0.12
110 0.09
111 0.1
112 0.12
113 0.17
114 0.18
115 0.22
116 0.25
117 0.25
118 0.26
119 0.3
120 0.36
121 0.41
122 0.48
123 0.49
124 0.5
125 0.48
126 0.49
127 0.44
128 0.4
129 0.32
130 0.28
131 0.24
132 0.23
133 0.24
134 0.24
135 0.24
136 0.21
137 0.2
138 0.17
139 0.2
140 0.19
141 0.17
142 0.17
143 0.19
144 0.2
145 0.19
146 0.17
147 0.13
148 0.1
149 0.1
150 0.09
151 0.06
152 0.05
153 0.04
154 0.05
155 0.05
156 0.05
157 0.05
158 0.06
159 0.09
160 0.1
161 0.13
162 0.14
163 0.14
164 0.14
165 0.18
166 0.2
167 0.21
168 0.26
169 0.28
170 0.28
171 0.28
172 0.32
173 0.31
174 0.29
175 0.27
176 0.22
177 0.2
178 0.19
179 0.18
180 0.18
181 0.16
182 0.13
183 0.11
184 0.12
185 0.1
186 0.1
187 0.1
188 0.09
189 0.12
190 0.12
191 0.13
192 0.12
193 0.13
194 0.14
195 0.14
196 0.14
197 0.12
198 0.14
199 0.17
200 0.2
201 0.2
202 0.18
203 0.18
204 0.21
205 0.25
206 0.24
207 0.24
208 0.22
209 0.21
210 0.23
211 0.26
212 0.28
213 0.26
214 0.26
215 0.25
216 0.29
217 0.29
218 0.33
219 0.32
220 0.27
221 0.25
222 0.25
223 0.28
224 0.26
225 0.29
226 0.28
227 0.28
228 0.27
229 0.26
230 0.28
231 0.23
232 0.2
233 0.19
234 0.16
235 0.14
236 0.14
237 0.14
238 0.11
239 0.1
240 0.09
241 0.06
242 0.06
243 0.06
244 0.08
245 0.12
246 0.13
247 0.16
248 0.16
249 0.16
250 0.18
251 0.19
252 0.2
253 0.17
254 0.17
255 0.17
256 0.17
257 0.17
258 0.16
259 0.16
260 0.14
261 0.16
262 0.14
263 0.19
264 0.19
265 0.2
266 0.25
267 0.24
268 0.23
269 0.21
270 0.22
271 0.22
272 0.27
273 0.3
274 0.25
275 0.25
276 0.27
277 0.29
278 0.3
279 0.25
280 0.22
281 0.22
282 0.25
283 0.28
284 0.27
285 0.26
286 0.27
287 0.27
288 0.26
289 0.22
290 0.19
291 0.17
292 0.16
293 0.13
294 0.1
295 0.1
296 0.07
297 0.09
298 0.09
299 0.09
300 0.1
301 0.1
302 0.1
303 0.11
304 0.11
305 0.09
306 0.09
307 0.09
308 0.08
309 0.1
310 0.13
311 0.14
312 0.15
313 0.15
314 0.16
315 0.15
316 0.16
317 0.14
318 0.12
319 0.16
320 0.2
321 0.22
322 0.24
323 0.25
324 0.22
325 0.23
326 0.22
327 0.16
328 0.13
329 0.13
330 0.11
331 0.13
332 0.15
333 0.15
334 0.16
335 0.17
336 0.17
337 0.16
338 0.16
339 0.15
340 0.2
341 0.19
342 0.22
343 0.28
344 0.31
345 0.38
346 0.45
347 0.48
348 0.44
349 0.5
350 0.48
351 0.43
352 0.46