Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7RDI5

Protein Details
Accession A0A1X7RDI5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
72-101YMFFCRRCKPPDKCRYHPFCRQRLTPRTPNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, plas 4, E.R. 4, mito 2, golg 2
Family & Domain DBs
Amino Acid Sequences MASYTLSLRYALIGIVVGCAGLVSALKTCSVERQTVHEQIVSVNTEVLSNTTLPTGLEGRRKDIAPSTRSPYMFFCRRCKPPDKCRYHPFCRQRLTPRTPNDQYYTFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.05
5 0.04
6 0.04
7 0.03
8 0.03
9 0.03
10 0.03
11 0.05
12 0.05
13 0.06
14 0.07
15 0.08
16 0.14
17 0.16
18 0.18
19 0.18
20 0.25
21 0.3
22 0.32
23 0.33
24 0.27
25 0.25
26 0.23
27 0.24
28 0.18
29 0.13
30 0.1
31 0.09
32 0.08
33 0.08
34 0.08
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.08
43 0.09
44 0.15
45 0.16
46 0.19
47 0.21
48 0.21
49 0.21
50 0.26
51 0.3
52 0.28
53 0.32
54 0.34
55 0.37
56 0.37
57 0.38
58 0.36
59 0.37
60 0.4
61 0.42
62 0.43
63 0.47
64 0.53
65 0.58
66 0.64
67 0.66
68 0.69
69 0.75
70 0.77
71 0.79
72 0.83
73 0.86
74 0.83
75 0.84
76 0.83
77 0.81
78 0.79
79 0.79
80 0.78
81 0.79
82 0.81
83 0.79
84 0.77
85 0.78
86 0.76
87 0.73
88 0.69