Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7S2N3

Protein Details
Accession A0A1X7S2N3    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
116-137NELFGFKKMRNYKPRTLAKQALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 11, cyto 8, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045180  La_dom_prot  
IPR006630  La_HTH  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF05383  La  
PROSITE View protein in PROSITE  
PS50961  HTH_LA  
Amino Acid Sequences METNIQSSPAMPATSASIAAEKAIEPTSLTSNTNTIDQSSDTVQSPTTAMTAPPTFSEMPATTSTDLAVQEPPKVHPDAAEIIRQIEFYLSDDNLPGDAHLLARTGPTGDGWVSINELFGFKKMRNYKPRTLAKQALLMSDKLIPSTMIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.11
5 0.11
6 0.11
7 0.11
8 0.08
9 0.09
10 0.1
11 0.09
12 0.09
13 0.11
14 0.14
15 0.16
16 0.17
17 0.15
18 0.16
19 0.17
20 0.19
21 0.17
22 0.14
23 0.14
24 0.13
25 0.14
26 0.13
27 0.14
28 0.13
29 0.13
30 0.13
31 0.12
32 0.12
33 0.1
34 0.09
35 0.08
36 0.07
37 0.1
38 0.1
39 0.1
40 0.1
41 0.13
42 0.13
43 0.12
44 0.15
45 0.12
46 0.14
47 0.15
48 0.17
49 0.14
50 0.14
51 0.14
52 0.12
53 0.12
54 0.1
55 0.11
56 0.1
57 0.11
58 0.12
59 0.13
60 0.14
61 0.14
62 0.13
63 0.11
64 0.13
65 0.15
66 0.16
67 0.16
68 0.14
69 0.14
70 0.14
71 0.14
72 0.12
73 0.08
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.06
84 0.05
85 0.05
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.07
96 0.07
97 0.08
98 0.08
99 0.08
100 0.1
101 0.09
102 0.1
103 0.09
104 0.1
105 0.09
106 0.1
107 0.13
108 0.12
109 0.22
110 0.3
111 0.4
112 0.5
113 0.57
114 0.64
115 0.72
116 0.81
117 0.8
118 0.8
119 0.78
120 0.71
121 0.7
122 0.62
123 0.58
124 0.5
125 0.42
126 0.35
127 0.31
128 0.28
129 0.21
130 0.2