Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7RZZ9

Protein Details
Accession A0A1X7RZZ9    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
132-155AGVPKTPAPKKRTARKTVIKAEDMHydrophilic
NLS Segment(s)
PositionSequence
83-87AKKRK
107-115PKKHARGKK
141-143KKR
Subcellular Location(s) nucl 12.5, cyto_nucl 12.333, cyto 10, mito_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MSYNYQIAKDAISQPEKDRAFCIFLNTTNGVTNWEKATTDFKSASVDSMKVSWRNTLKKIEKAGGKLDGDNTSTTPATPKSSAKKRKAEKEDSANDGEDVAPATPAPKKHARGKKAAASTVDKSDDGEYVEAGVPKTPAPKKRTARKTVIKAEDMDDVEGADDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.42
3 0.42
4 0.39
5 0.36
6 0.31
7 0.32
8 0.3
9 0.32
10 0.25
11 0.26
12 0.3
13 0.29
14 0.27
15 0.25
16 0.24
17 0.23
18 0.22
19 0.22
20 0.18
21 0.18
22 0.17
23 0.17
24 0.23
25 0.2
26 0.23
27 0.21
28 0.2
29 0.23
30 0.22
31 0.23
32 0.2
33 0.18
34 0.14
35 0.16
36 0.19
37 0.18
38 0.19
39 0.22
40 0.27
41 0.32
42 0.35
43 0.43
44 0.46
45 0.48
46 0.51
47 0.51
48 0.48
49 0.45
50 0.44
51 0.39
52 0.34
53 0.29
54 0.27
55 0.23
56 0.2
57 0.18
58 0.15
59 0.13
60 0.12
61 0.11
62 0.11
63 0.1
64 0.12
65 0.13
66 0.17
67 0.23
68 0.33
69 0.43
70 0.5
71 0.58
72 0.62
73 0.7
74 0.75
75 0.75
76 0.72
77 0.71
78 0.67
79 0.62
80 0.57
81 0.47
82 0.38
83 0.31
84 0.24
85 0.14
86 0.11
87 0.07
88 0.05
89 0.04
90 0.06
91 0.08
92 0.09
93 0.14
94 0.21
95 0.26
96 0.36
97 0.45
98 0.49
99 0.56
100 0.62
101 0.64
102 0.62
103 0.61
104 0.55
105 0.52
106 0.49
107 0.44
108 0.4
109 0.32
110 0.28
111 0.25
112 0.22
113 0.18
114 0.15
115 0.11
116 0.1
117 0.12
118 0.12
119 0.11
120 0.11
121 0.11
122 0.11
123 0.2
124 0.25
125 0.31
126 0.36
127 0.46
128 0.55
129 0.66
130 0.75
131 0.76
132 0.8
133 0.83
134 0.87
135 0.87
136 0.84
137 0.77
138 0.69
139 0.62
140 0.58
141 0.49
142 0.4
143 0.29
144 0.22