Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X7RK56

Protein Details
Accession A0A1X7RK56    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-71SSSKSGPPSKSKKPSGPKPAPTQHKPKPTVDNRRKKPPHMKYTEKEHydrophilic
150-177SLEDRKQNIKDDSKKRRRSDSEVAKPAKHydrophilic
NLS Segment(s)
PositionSequence
4-70KPKSGGPAKASNKRPGKPSSGGSSSKSGPPSKSKKPSGPKPAPTQHKPKPTVDNRRKKPPHMKYTEK
87-93KPPNAKK
142-192KRTQSKKESLEDRKQNIKDDSKKRRRSDSEVAKPAKEEVQGSKKAKLRKRV
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
Amino Acid Sequences MPPKPKSGGPAKASNKRPGKPSSGGSSSKSGPPSKSKKPSGPKPAPTQHKPKPTVDNRRKKPPHMKYTEKELKVPQLNGIRPAGVSKPPNAKKGKNFVDDKESMNAILAMVMAEKEGNIESKMMRARQMEEVREARRIEAEKRTQSKKESLEDRKQNIKDDSKKRRRSDSEVAKPAKEEVQGSKKAKLRKRVSFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.7
4 0.71
5 0.67
6 0.65
7 0.61
8 0.6
9 0.58
10 0.56
11 0.55
12 0.51
13 0.49
14 0.44
15 0.43
16 0.43
17 0.39
18 0.37
19 0.43
20 0.48
21 0.54
22 0.62
23 0.65
24 0.69
25 0.76
26 0.81
27 0.83
28 0.84
29 0.81
30 0.81
31 0.83
32 0.83
33 0.8
34 0.8
35 0.77
36 0.77
37 0.74
38 0.7
39 0.71
40 0.72
41 0.76
42 0.77
43 0.8
44 0.77
45 0.83
46 0.83
47 0.82
48 0.82
49 0.81
50 0.81
51 0.79
52 0.81
53 0.73
54 0.79
55 0.79
56 0.69
57 0.62
58 0.53
59 0.52
60 0.47
61 0.44
62 0.39
63 0.36
64 0.35
65 0.35
66 0.33
67 0.25
68 0.21
69 0.22
70 0.18
71 0.16
72 0.16
73 0.18
74 0.27
75 0.3
76 0.38
77 0.41
78 0.44
79 0.46
80 0.54
81 0.57
82 0.54
83 0.53
84 0.47
85 0.49
86 0.46
87 0.42
88 0.34
89 0.27
90 0.2
91 0.17
92 0.16
93 0.09
94 0.07
95 0.05
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.05
105 0.05
106 0.06
107 0.06
108 0.1
109 0.13
110 0.14
111 0.17
112 0.18
113 0.2
114 0.28
115 0.32
116 0.31
117 0.34
118 0.38
119 0.36
120 0.39
121 0.37
122 0.29
123 0.29
124 0.3
125 0.28
126 0.32
127 0.38
128 0.42
129 0.49
130 0.55
131 0.55
132 0.57
133 0.6
134 0.57
135 0.57
136 0.58
137 0.61
138 0.65
139 0.69
140 0.71
141 0.73
142 0.7
143 0.68
144 0.65
145 0.66
146 0.66
147 0.67
148 0.73
149 0.74
150 0.82
151 0.81
152 0.85
153 0.82
154 0.81
155 0.82
156 0.81
157 0.81
158 0.81
159 0.79
160 0.7
161 0.63
162 0.56
163 0.49
164 0.4
165 0.33
166 0.32
167 0.36
168 0.45
169 0.47
170 0.52
171 0.54
172 0.6
173 0.65
174 0.67
175 0.68