Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8ZP43

Protein Details
Accession G8ZP43   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-100LQGIRKRCKVVRKRQRNQAVKEKAHydrophilic
NLS Segment(s)
PositionSequence
87-100VRKRQRNQAVKEKA
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG tdl:TDEL_0B02580  -  
Amino Acid Sequences MDVRYNFLNTLDHYPCELIRTLWTLQSLDLQQSEPNVPEERRKWLAMQMSTQAELLEQLTEERIKALQSHREDLVQLQGIRKRCKVVRKRQRNQAVKEKANKLTIKLNLKPKGHTQPARVQNVKSIEEEPEEKYCFCNNVSYGAMIACDNDNCPLEWFHYGCVGMNKPPNGKWYCSTQCREQAKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.25
4 0.23
5 0.16
6 0.17
7 0.2
8 0.19
9 0.2
10 0.21
11 0.19
12 0.19
13 0.22
14 0.21
15 0.19
16 0.19
17 0.17
18 0.16
19 0.18
20 0.19
21 0.16
22 0.18
23 0.19
24 0.2
25 0.27
26 0.29
27 0.34
28 0.36
29 0.36
30 0.35
31 0.36
32 0.42
33 0.36
34 0.37
35 0.34
36 0.32
37 0.31
38 0.3
39 0.24
40 0.17
41 0.15
42 0.12
43 0.07
44 0.05
45 0.05
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.11
53 0.14
54 0.21
55 0.23
56 0.26
57 0.26
58 0.27
59 0.26
60 0.24
61 0.23
62 0.19
63 0.16
64 0.17
65 0.2
66 0.25
67 0.28
68 0.28
69 0.3
70 0.3
71 0.4
72 0.47
73 0.54
74 0.6
75 0.69
76 0.76
77 0.81
78 0.87
79 0.86
80 0.82
81 0.82
82 0.8
83 0.74
84 0.73
85 0.69
86 0.62
87 0.6
88 0.53
89 0.45
90 0.42
91 0.42
92 0.41
93 0.41
94 0.47
95 0.48
96 0.49
97 0.49
98 0.49
99 0.52
100 0.54
101 0.53
102 0.49
103 0.51
104 0.58
105 0.64
106 0.59
107 0.51
108 0.48
109 0.48
110 0.45
111 0.37
112 0.3
113 0.23
114 0.24
115 0.25
116 0.22
117 0.22
118 0.22
119 0.2
120 0.21
121 0.2
122 0.2
123 0.19
124 0.2
125 0.17
126 0.19
127 0.2
128 0.18
129 0.17
130 0.15
131 0.15
132 0.1
133 0.11
134 0.08
135 0.08
136 0.08
137 0.1
138 0.11
139 0.11
140 0.13
141 0.13
142 0.14
143 0.18
144 0.18
145 0.16
146 0.18
147 0.18
148 0.18
149 0.22
150 0.22
151 0.24
152 0.3
153 0.33
154 0.35
155 0.37
156 0.44
157 0.42
158 0.44
159 0.41
160 0.45
161 0.5
162 0.55
163 0.58
164 0.58
165 0.64
166 0.7
167 0.77