Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X7RD45

Protein Details
Accession A0A1X7RD45    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-52AKMRAKWGEKRVRRLKSKRRRTRAQCRWATQHydrophilic
NLS Segment(s)
PositionSequence
24-44MRAKWGEKRVRRLKSKRRRTR
Subcellular Location(s) mito 13, nucl 11, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MVGPIPAATASDHRHTSIYTTAKMRAKWGEKRVRRLKSKRRRTRAQCRWATQLHHVRSATTTARTPQKSEPVTRPPRKLDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.24
4 0.27
5 0.27
6 0.26
7 0.27
8 0.32
9 0.35
10 0.36
11 0.37
12 0.37
13 0.41
14 0.45
15 0.53
16 0.56
17 0.59
18 0.69
19 0.74
20 0.75
21 0.78
22 0.81
23 0.82
24 0.83
25 0.88
26 0.88
27 0.88
28 0.9
29 0.89
30 0.9
31 0.9
32 0.89
33 0.86
34 0.8
35 0.77
36 0.7
37 0.63
38 0.61
39 0.59
40 0.51
41 0.49
42 0.45
43 0.39
44 0.37
45 0.38
46 0.31
47 0.25
48 0.24
49 0.24
50 0.33
51 0.34
52 0.37
53 0.39
54 0.45
55 0.48
56 0.52
57 0.55
58 0.57
59 0.66
60 0.71
61 0.73